BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0100 (586 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AK128666-1|BAC87560.1| 167|Homo sapiens protein ( Homo sapiens ... 30 6.9 >AK128666-1|BAC87560.1| 167|Homo sapiens protein ( Homo sapiens cDNA FLJ46826 fis, clone UTERU2014998. ). Length = 167 Score = 29.9 bits (64), Expect = 6.9 Identities = 17/54 (31%), Positives = 29/54 (53%) Frame = +3 Query: 168 PLNKSHQI*RCMLSSLPVWLWVCWPRKTHLSERRPRMQTDFKSAALQRVLRPIQ 329 P+ Q C +S P+W+W+C P + ++ RPR+ SA+ +V+ P Q Sbjct: 35 PMTIRKQNGSCPSTSCPLWVWLCHPSWSAVA--RPRLAA--ASASWAQVILPPQ 84 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 77,975,503 Number of Sequences: 237096 Number of extensions: 1548420 Number of successful extensions: 2843 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2813 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2843 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 6098631048 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -