BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= e96h0100
(586 letters)
Database: human
237,096 sequences; 76,859,062 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AK128666-1|BAC87560.1| 167|Homo sapiens protein ( Homo sapiens ... 30 6.9
>AK128666-1|BAC87560.1| 167|Homo sapiens protein ( Homo sapiens
cDNA FLJ46826 fis, clone UTERU2014998. ).
Length = 167
Score = 29.9 bits (64), Expect = 6.9
Identities = 17/54 (31%), Positives = 29/54 (53%)
Frame = +3
Query: 168 PLNKSHQI*RCMLSSLPVWLWVCWPRKTHLSERRPRMQTDFKSAALQRVLRPIQ 329
P+ Q C +S P+W+W+C P + ++ RPR+ SA+ +V+ P Q
Sbjct: 35 PMTIRKQNGSCPSTSCPLWVWLCHPSWSAVA--RPRLAA--ASASWAQVILPPQ 84
Database: human
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 76,859,062
Number of sequences in database: 237,096
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 77,975,503
Number of Sequences: 237096
Number of extensions: 1548420
Number of successful extensions: 2843
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 2813
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2843
length of database: 76,859,062
effective HSP length: 86
effective length of database: 56,468,806
effective search space used: 6098631048
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -