BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0100 (586 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 23 2.9 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 23 2.9 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 22 5.1 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 22 5.1 EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 21 6.7 AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein... 21 8.9 AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein... 21 8.9 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 22.6 bits (46), Expect = 2.9 Identities = 15/62 (24%), Positives = 27/62 (43%) Frame = -3 Query: 461 RVREXXXXXXXXXXSRRPTGDNGRNVSNTVRLMTFSSFATTWLSLNWP*YALQCGRLKVR 282 R+RE SR P + N SNT + + S+ + +N A + ++K+ Sbjct: 68 RIREIEKLGSERSKSRSPDSRDRSNTSNTSKTVILSNKGPEGIQIN----ATELQKIKLE 123 Query: 281 LH 276 +H Sbjct: 124 IH 125 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 22.6 bits (46), Expect = 2.9 Identities = 15/62 (24%), Positives = 27/62 (43%) Frame = -3 Query: 461 RVREXXXXXXXXXXSRRPTGDNGRNVSNTVRLMTFSSFATTWLSLNWP*YALQCGRLKVR 282 R+RE SR P + N SNT + + S+ + +N A + ++K+ Sbjct: 68 RIREIEKLGSERSKSRSPDSRDRSNTSNTSKTIILSNKGPEGIQIN----ATELQKIKLE 123 Query: 281 LH 276 +H Sbjct: 124 IH 125 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 21.8 bits (44), Expect = 5.1 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +1 Query: 316 YGQFKDNHVVANELKVI 366 Y Q K+N + AN +K++ Sbjct: 332 YAQHKENELYANLMKIV 348 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 21.8 bits (44), Expect = 5.1 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +1 Query: 316 YGQFKDNHVVANELKVI 366 Y Q K+N + AN +K++ Sbjct: 370 YAQHKENELYANLMKIV 386 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 21.4 bits (43), Expect = 6.7 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = +2 Query: 395 HYLLSASYFNNYQTXQGRIRELFRK 469 HYL + S NY + +++E F K Sbjct: 576 HYLDAKSSVQNYSLAKHQLKEAFVK 600 >AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 21.0 bits (42), Expect = 8.9 Identities = 10/28 (35%), Positives = 13/28 (46%) Frame = +2 Query: 200 YALIVACLALGVLAEEDSSIRTSTKDAD 283 Y CLA+G+ E R TK+ D Sbjct: 164 YCRYQKCLAMGMKREAVQEERQRTKERD 191 >AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 21.0 bits (42), Expect = 8.9 Identities = 10/28 (35%), Positives = 13/28 (46%) Frame = +2 Query: 200 YALIVACLALGVLAEEDSSIRTSTKDAD 283 Y CLA+G+ E R TK+ D Sbjct: 164 YCRYQKCLAMGMKREAVQEERQRTKERD 191 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 154,652 Number of Sequences: 438 Number of extensions: 3315 Number of successful extensions: 9 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16993167 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -