BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0099 (645 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride... 23 3.3 DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride... 23 3.3 DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride... 23 3.3 DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride... 23 3.3 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 22 4.4 >DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride channel variant 4 protein. Length = 489 Score = 22.6 bits (46), Expect = 3.3 Identities = 9/43 (20%), Positives = 19/43 (44%) Frame = -2 Query: 368 DKNLQIHAIFYLKKKKDISYLHNTLKLIQMQGHTAVFLLDTPM 240 D + +H + + ++YL ++ QG +F D P+ Sbjct: 157 DPLIPVHFALRIYRNGTVNYLMRRHLILSCQGRLNIFPFDDPL 199 >DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride channel variant 3 protein. Length = 475 Score = 22.6 bits (46), Expect = 3.3 Identities = 9/43 (20%), Positives = 19/43 (44%) Frame = -2 Query: 368 DKNLQIHAIFYLKKKKDISYLHNTLKLIQMQGHTAVFLLDTPM 240 D + +H + + ++YL ++ QG +F D P+ Sbjct: 157 DPLIPVHFALRIYRNGTVNYLMRRHLILSCQGRLNIFPFDDPL 199 >DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride channel variant 1 protein. Length = 509 Score = 22.6 bits (46), Expect = 3.3 Identities = 9/43 (20%), Positives = 19/43 (44%) Frame = -2 Query: 368 DKNLQIHAIFYLKKKKDISYLHNTLKLIQMQGHTAVFLLDTPM 240 D + +H + + ++YL ++ QG +F D P+ Sbjct: 208 DPLIPVHFALRIYRNGTVNYLMRRHLILSCQGRLNIFPFDDPL 250 >DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride channel protein. Length = 458 Score = 22.6 bits (46), Expect = 3.3 Identities = 9/43 (20%), Positives = 19/43 (44%) Frame = -2 Query: 368 DKNLQIHAIFYLKKKKDISYLHNTLKLIQMQGHTAVFLLDTPM 240 D + +H + + ++YL ++ QG +F D P+ Sbjct: 157 DPLIPVHFALRIYRNGTVNYLMRRHLILSCQGRLNIFPFDDPL 199 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 22.2 bits (45), Expect = 4.4 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -3 Query: 508 PDNFQYYNLFIILLKTNSFFLLPLIL 431 PD +YN I+ + S F +P I+ Sbjct: 333 PDQCLFYNTDFIIYSSLSSFYIPCII 358 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 160,799 Number of Sequences: 438 Number of extensions: 3212 Number of successful extensions: 11 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19438227 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -