BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0097 (689 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 24 5.2 AY028784-1|AAK32958.2| 499|Anopheles gambiae cytochrome P450 pr... 24 5.2 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 23.8 bits (49), Expect = 5.2 Identities = 14/41 (34%), Positives = 19/41 (46%) Frame = -1 Query: 344 ATRSRRACTASHVPDPITARPVPPDISASNWTSHLASVETL 222 +T S A A+ VP+P+ A P P A T+ S L Sbjct: 925 STPSTSAMAATIVPNPVQASPSPATAPAPAKTTSTDSTNGL 965 >AY028784-1|AAK32958.2| 499|Anopheles gambiae cytochrome P450 protein. Length = 499 Score = 23.8 bits (49), Expect = 5.2 Identities = 10/21 (47%), Positives = 12/21 (57%), Gaps = 1/21 (4%) Frame = +3 Query: 480 FNRSYG-WVWYPIPFLRPGLP 539 FN+ Y WV +PFL P P Sbjct: 20 FNQRYRFWVERQVPFLEPSFP 40 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 660,742 Number of Sequences: 2352 Number of extensions: 12164 Number of successful extensions: 18 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 69831885 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -