BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0093 (391 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U41274-6|AAA82462.1| 601|Caenorhabditis elegans Hypothetical pr... 27 6.2 Z54342-9|CAA91153.1| 399|Caenorhabditis elegans Hypothetical pr... 26 8.2 >U41274-6|AAA82462.1| 601|Caenorhabditis elegans Hypothetical protein T04G9.6 protein. Length = 601 Score = 26.6 bits (56), Expect = 6.2 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +1 Query: 49 SDGYRSDFACITFVKKLISESINFLTAMANS 141 SD Y SDFA + SE+ ++LTA +S Sbjct: 345 SDSYSSDFASTAIPEASESENSDYLTASVSS 375 >Z54342-9|CAA91153.1| 399|Caenorhabditis elegans Hypothetical protein C08H9.14 protein. Length = 399 Score = 26.2 bits (55), Expect = 8.2 Identities = 15/64 (23%), Positives = 31/64 (48%) Frame = -3 Query: 305 RFTFDVSRSVFQVTHRSLHVGFV*INLYWILTLGKNITPALFSKLITERSPNLIIEFAMA 126 +F + F + +S+ + L ++++G + LFS ++ ++ LI A+ Sbjct: 87 KFKYGTKDGFFDMKRKSMELNR---GLKVMVSIGGYESSPLFSDVLVKKKKKLIASIALL 143 Query: 125 VKKF 114 VKKF Sbjct: 144 VKKF 147 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,704,934 Number of Sequences: 27780 Number of extensions: 165220 Number of successful extensions: 336 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 333 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 336 length of database: 12,740,198 effective HSP length: 74 effective length of database: 10,684,478 effective search space used: 587646290 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -