BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0091 (847 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_02_0031 - 5832475-5832696,5832789-5833064,5833303-5833380,583... 35 0.071 02_02_0121 + 7005356-7005418,7007533-7007632,7007713-7007810,700... 34 0.12 01_01_0653 - 4981517-4981738,4981841-4981976,4982066-4982121,498... 31 0.87 05_01_0177 + 1231679-1231753,1232259-1232546,1232608-1232685,123... 30 2.0 02_05_0977 - 33239887-33240566,33241010-33241985 30 2.0 10_08_0364 + 17217631-17217833,17218134-17218308,17218391-172184... 29 3.5 03_03_0160 + 14957139-14957603,14958054-14958113,14959012-14959776 29 3.5 01_04_0006 - 15001969-15002078,15002160-15002224,15002324-150024... 29 3.5 01_01_0620 - 4621291-4621379,4621722-4621803,4622238-4622282,462... 29 3.5 09_03_0057 + 11944973-11947159 29 4.7 12_01_0199 - 1467137-1467172,1467302-1467391,1468304-1468396,146... 29 6.2 10_02_0155 + 5937974-5939419,5939678-5939867,5940895-5941022 29 6.2 03_02_0312 - 7326092-7326148,7326415-7326540,7327744-7327821,732... 29 6.2 01_01_0942 + 7428384-7429536,7429623-7430335 29 6.2 10_02_0185 - 6386761-6387122,6387589-6387826,6388215-6389696 28 8.1 05_06_0042 - 25131962-25132149,25132261-25132345,25132750-251327... 28 8.1 01_03_0020 - 11698429-11699126,11699557-11700532 28 8.1 >05_02_0031 - 5832475-5832696,5832789-5833064,5833303-5833380, 5833464-5833550,5833639-5833699,5833792-5833880, 5834001-5834098,5834197-5834296,5834876-5834953 Length = 362 Score = 35.1 bits (77), Expect = 0.071 Identities = 20/69 (28%), Positives = 32/69 (46%) Frame = +3 Query: 3 GANVLARFALIHPKKVDALTLINCTSNQAGWIEWAYQKMNTRSLRSRGMTQGVLDYLLWH 182 GA VL FA + ++V L L++ W EW Y K+ + G V + LL Sbjct: 134 GAYVLTLFATKYRERVIGLMLVSPLCRAPSWSEWLYNKVLLNLIYYYGTRGLVKECLLQR 193 Query: 183 HFGRFPEDR 209 +F + ++R Sbjct: 194 YFSKLLDER 202 >02_02_0121 + 7005356-7005418,7007533-7007632,7007713-7007810, 7007933-7008021,7008111-7008171,7008253-7008339, 7008409-7008486,7008583-7008639,7008731-7008786, 7008877-7009012,7009103-7009324 Length = 348 Score = 34.3 bits (75), Expect = 0.12 Identities = 20/64 (31%), Positives = 30/64 (46%) Frame = +3 Query: 3 GANVLARFALIHPKKVDALTLINCTSNQAGWIEWAYQKMNTRSLRSRGMTQGVLDYLLWH 182 GA +L FA + +V L L++ W EW Y K+ + L GM V + LL Sbjct: 129 GAYILTLFAAKYRDRVLGLILVSPLCKPPTWTEWFYNKVASNLLYYYGMCGLVKEGLLQR 188 Query: 183 HFGR 194 +F + Sbjct: 189 YFSK 192 >01_01_0653 - 4981517-4981738,4981841-4981976,4982066-4982121, 4982228-4982284,4982373-4982450,4982533-4982619, 4982707-4982767,4982862-4982950,4983048-4983145, 4983242-4983341,4983983-4984042 Length = 347 Score = 31.5 bits (68), Expect = 0.87 Identities = 19/62 (30%), Positives = 27/62 (43%) Frame = +3 Query: 3 GANVLARFALIHPKKVDALTLINCTSNQAGWIEWAYQKMNTRSLRSRGMTQGVLDYLLWH 182 GA +L FA + +V L L++ W EW Y K+ L G V + LL Sbjct: 128 GAYILTLFATKYRDRVIGLMLVSPLCKAPSWSEWLYNKVLLNLLYYYGSRGLVKECLLQR 187 Query: 183 HF 188 +F Sbjct: 188 YF 189 >05_01_0177 + 1231679-1231753,1232259-1232546,1232608-1232685, 1233458-1233673,1233862-1233981,1234079-1234804 Length = 500 Score = 30.3 bits (65), Expect = 2.0 Identities = 16/48 (33%), Positives = 25/48 (52%) Frame = +2 Query: 398 FNGRLNPNNSTWMKISDCAMVLEEQPSKISEAFRLFLRARAMVRICNL 541 F G L NS+W+ IS A + + I++A R R +VR+ +L Sbjct: 117 FRGYLLSENSSWLFISSAAFIYHCVGANITKARRALRALRGLVRLKSL 164 >02_05_0977 - 33239887-33240566,33241010-33241985 Length = 551 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = +2 Query: 371 SPHVDDTVTFNGRLNPNNSTWMKISDC 451 SP +DTVT GR +PN +T + I C Sbjct: 414 SPGQEDTVTAQGRSDPNQNTGISIHRC 440 >10_08_0364 + 17217631-17217833,17218134-17218308,17218391-17218474, 17218561-17218802,17218883-17219108,17219246-17219325, 17219408-17219492,17219665-17219796,17219927-17220040, 17220123-17220170,17220413-17220497,17220722-17220834 Length = 528 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +2 Query: 245 HT*LNPSNLSMFIEAYVRRSDLGICRNADTIKVPVLN 355 H + P NL + ++R SD G+C+ D P LN Sbjct: 234 HRDIKPDNLLLDRHGHLRLSDFGLCKPLDYSNFPDLN 270 >03_03_0160 + 14957139-14957603,14958054-14958113,14959012-14959776 Length = 429 Score = 29.5 bits (63), Expect = 3.5 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = -2 Query: 243 NSSCTSGSDRGCGLRGNVRNDATKGSPARPGSCHGNEGTECSSS 112 +SS T G+D G G RG + GS +G+E SSS Sbjct: 5 HSSVTPGNDSGSGRRGRGSGSGSGSGRRSRGSDRSGDGSEDSSS 48 >01_04_0006 - 15001969-15002078,15002160-15002224,15002324-15002409, 15003243-15003341,15003556-15003649,15004813-15004982, 15005322-15005417 Length = 239 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/42 (28%), Positives = 24/42 (57%) Frame = -2 Query: 540 KLQILTIALALKKRRNASEILLGCSSSTIAQSEIFIQVELFG 415 +L ++A+A+ KRR + + +GC + +++ EI V G Sbjct: 152 RLDAASLAIAIMKRRLRARVFVGCDNQPLSRQEIMDLVNRSG 193 >01_01_0620 - 4621291-4621379,4621722-4621803,4622238-4622282, 4623701-4623892,4625224-4625337,4625430-4625561, 4626356-4626440,4626526-4626605,4626791-4627034, 4627376-4627617,4628232-4628315,4628427-4628601, 4629351-4629464,4630025-4630236 Length = 629 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +2 Query: 245 HT*LNPSNLSMFIEAYVRRSDLGICRNADTIKVPVLN 355 H + P NL + +++ SD G+C+ D K+ LN Sbjct: 275 HRDIKPDNLLLDKNGHMKLSDFGLCKPIDCSKLSTLN 311 >09_03_0057 + 11944973-11947159 Length = 728 Score = 29.1 bits (62), Expect = 4.7 Identities = 21/66 (31%), Positives = 34/66 (51%), Gaps = 2/66 (3%) Frame = +2 Query: 431 WMKISDCAMVLEEQPSKISEAFRLFLRARAMV--RICNLQASITKNILPLLYLNRLSIIN 604 W+ +SD V ++++ F F A M +CNLQ S+T++I+ +L L + Sbjct: 290 WISVSDDFNV-----KRLTKEFIEFALANWMQSDNLCNLQQSLTESIVKFRFLLVLDDVW 344 Query: 605 YDVYLN 622 DVY N Sbjct: 345 DDVYAN 350 >12_01_0199 - 1467137-1467172,1467302-1467391,1468304-1468396, 1468488-1469515,1470005-1470552,1470656-1470695, 1473774-1475196 Length = 1085 Score = 28.7 bits (61), Expect = 6.2 Identities = 12/47 (25%), Positives = 26/47 (55%) Frame = +1 Query: 517 GYGKNL*FTSFNHKKYITTTLPQQIKYY*LRCIFKYEINIKTKNIFN 657 G NL +T +HK Y+ + + + Y C+++YE + +++F+ Sbjct: 644 GGSANLGYTQRDHKNYLRSRRQRDLLYDFSACMYEYEEKEEFEDVFD 690 >10_02_0155 + 5937974-5939419,5939678-5939867,5940895-5941022 Length = 587 Score = 28.7 bits (61), Expect = 6.2 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 5/50 (10%) Frame = +2 Query: 83 PGRMDRVGLPED--EHSVPS---FPWHDPGRAGLPFVASFRTFPRRPQPR 217 PGR+D P S PS P PG AG+P+ + F + P P P+ Sbjct: 35 PGRLDWANQPNPFLRFSPPSQIPLPNPPPGIAGIPYPSLFHSPPPPPSPQ 84 >03_02_0312 - 7326092-7326148,7326415-7326540,7327744-7327821, 7327916-7328178,7328699-7328741,7329581-7329632, 7329705-7329871,7330135-7330194,7330291-7330374, 7330654-7330758,7330840-7330899,7330976-7331032 Length = 383 Score = 28.7 bits (61), Expect = 6.2 Identities = 17/43 (39%), Positives = 23/43 (53%), Gaps = 2/43 (4%) Frame = -2 Query: 216 RGCGLRGNVRNDATKG--SPARPGSCHGNEGTECSSSGKPTRS 94 R G GN+ ATK +PA+P + NEG+ S SG + S Sbjct: 144 RSKGSLGNLDVVATKNKKAPAKPSASSSNEGSSHSESGSGSSS 186 >01_01_0942 + 7428384-7429536,7429623-7430335 Length = 621 Score = 28.7 bits (61), Expect = 6.2 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +2 Query: 374 PHVDDTVTFNGRLNPNNSTWMKISDCAMV 460 P ++TVT GR +PN ST + + C ++ Sbjct: 474 PGQENTVTAQGRRDPNQSTGISVHGCRLL 502 >10_02_0185 - 6386761-6387122,6387589-6387826,6388215-6389696 Length = 693 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = -1 Query: 412 ETSVEGNRVVYVR*QSTRDVQHRHLDGV 329 +T E + +VY+ + RD++HR LDG+ Sbjct: 94 DTRSECDELVYIPQEKLRDLEHRSLDGM 121 >05_06_0042 - 25131962-25132149,25132261-25132345,25132750-25132797, 25133084-25133197,25133279-25133410,25134029-25134124, 25134771-25135005,25135054-25135322,25135408-25135491, 25136529-25136703,25138018-25138229 Length = 545 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = +2 Query: 254 LNPSNLSMFIEAYVRRSDLGICRNADTIKVPVLN 355 + P NL + +++ SD G+C+ D+ P LN Sbjct: 249 IKPDNLLLDRSGHLKLSDFGLCKPLDSSNFPNLN 282 >01_03_0020 - 11698429-11699126,11699557-11700532 Length = 557 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +2 Query: 386 DTVTFNGRLNPNNSTWMKISDCAMV 460 +TVT GR +PN +T I CA+V Sbjct: 419 NTVTAQGRTDPNQNTGTTIQGCAIV 443 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,611,256 Number of Sequences: 37544 Number of extensions: 492262 Number of successful extensions: 1493 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 1446 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1492 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2350456800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -