BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0091 (847 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization prot... 25 1.2 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 23 4.7 AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 23 4.7 DQ435331-1|ABD92646.1| 135|Apis mellifera OBP14 protein. 22 6.2 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 22 6.2 AY739659-1|AAU85298.1| 288|Apis mellifera hyperpolarization-act... 22 6.2 AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 22 6.2 AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-act... 22 6.2 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 22 6.2 DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex det... 22 8.2 DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex det... 22 8.2 DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex det... 22 8.2 DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex det... 22 8.2 DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex det... 22 8.2 DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex det... 22 8.2 DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex det... 22 8.2 DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex det... 22 8.2 DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex det... 22 8.2 DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex det... 22 8.2 DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex det... 22 8.2 DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex det... 22 8.2 DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. 22 8.2 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 22 8.2 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 22 8.2 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 22 8.2 >DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization protein protein. Length = 250 Score = 24.6 bits (51), Expect = 1.2 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = -2 Query: 519 ALALKKRRNASEILLGCSSST 457 A L KRR+ SE LG +SST Sbjct: 164 AALLSKRRSVSECSLGTASST 184 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 22.6 bits (46), Expect = 4.7 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -2 Query: 201 RGNVRNDATKGSPARPGS 148 RG+V N + GSP P S Sbjct: 311 RGSVHNGSNNGSPRSPES 328 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 22.6 bits (46), Expect = 4.7 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = +2 Query: 254 LNPSNLSMFIEAYVRRSDLGICRNAD 331 L P NL + + YV+ D G + D Sbjct: 492 LKPENLLLDSQGYVKLVDFGFAKRLD 517 >DQ435331-1|ABD92646.1| 135|Apis mellifera OBP14 protein. Length = 135 Score = 22.2 bits (45), Expect = 6.2 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +2 Query: 422 NSTWMKISDCAMVLEEQP 475 NS +SDC+ + EE P Sbjct: 95 NSVKQLVSDCSTISEENP 112 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 22.2 bits (45), Expect = 6.2 Identities = 9/33 (27%), Positives = 17/33 (51%) Frame = +3 Query: 48 VDALTLINCTSNQAGWIEWAYQKMNTRSLRSRG 146 + +L L+N + N W ++A+ N + L G Sbjct: 548 IASLLLLNLSENHIEWFDYAFIPGNLKWLDIHG 580 >AY739659-1|AAU85298.1| 288|Apis mellifera hyperpolarization-activated ion channelvariant T protein. Length = 288 Score = 22.2 bits (45), Expect = 6.2 Identities = 7/25 (28%), Positives = 15/25 (60%) Frame = -3 Query: 221 QIVVAVFGETSEMMPQKVVQHALGH 147 ++ + +FG +M +++ Q A GH Sbjct: 54 KLAMKLFGSKKALMKERIRQKAAGH 78 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 22.2 bits (45), Expect = 6.2 Identities = 7/25 (28%), Positives = 15/25 (60%) Frame = -3 Query: 221 QIVVAVFGETSEMMPQKVVQHALGH 147 ++ + +FG +M +++ Q A GH Sbjct: 54 KLAMKLFGSKKALMKERIRQKAAGH 78 >AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-activated ion channel protein. Length = 632 Score = 22.2 bits (45), Expect = 6.2 Identities = 7/25 (28%), Positives = 15/25 (60%) Frame = -3 Query: 221 QIVVAVFGETSEMMPQKVVQHALGH 147 ++ + +FG +M +++ Q A GH Sbjct: 54 KLAMKLFGSKKALMKERIRQKAAGH 78 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 22.2 bits (45), Expect = 6.2 Identities = 14/45 (31%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = +1 Query: 325 RRHHQGAGVEHH--GCSVTSRRRHGYLQRTSQPEQFDLDEDLRLR 453 +RHH HH +V R Q+ Q Q E+ RLR Sbjct: 139 QRHHHLQNHHHHLQSTAVQDHHRPYQQQQQQQQRQQQRQEERRLR 183 >DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 21.8 bits (44), Expect = 8.2 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = -3 Query: 545 LVNYKFLP*PSPLRRGGMPPK 483 ++N + +P P P+ G PP+ Sbjct: 121 IINIEQIPVPVPVYYGNFPPR 141 >DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 21.8 bits (44), Expect = 8.2 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = -3 Query: 545 LVNYKFLP*PSPLRRGGMPPK 483 ++N + +P P P+ G PP+ Sbjct: 121 IINIEQIPVPVPVYYGNFPPR 141 >DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 8.2 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = -3 Query: 545 LVNYKFLP*PSPLRRGGMPPK 483 ++N + +P P P+ G PP+ Sbjct: 113 IINIEQIPVPVPIYCGNFPPR 133 >DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 8.2 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = -3 Query: 545 LVNYKFLP*PSPLRRGGMPPK 483 ++N + +P P P+ G PP+ Sbjct: 113 IINIEQIPVPVPIYCGNFPPR 133 >DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 8.2 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = -3 Query: 545 LVNYKFLP*PSPLRRGGMPPK 483 ++N + +P P P+ G PP+ Sbjct: 113 IINIEQIPVPVPIYCGNFPPR 133 >DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 8.2 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = -3 Query: 545 LVNYKFLP*PSPLRRGGMPPK 483 ++N + +P P P+ G PP+ Sbjct: 113 IINIEQIPVPVPIYCGNFPPR 133 >DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 8.2 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = -3 Query: 545 LVNYKFLP*PSPLRRGGMPPK 483 ++N + +P P P+ G PP+ Sbjct: 113 IINIEQIPVPVPIYCGNFPPR 133 >DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 8.2 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = -3 Query: 545 LVNYKFLP*PSPLRRGGMPPK 483 ++N + +P P P+ G PP+ Sbjct: 113 IINIEQIPVPVPIYCGNFPPR 133 >DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.8 bits (44), Expect = 8.2 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = -3 Query: 545 LVNYKFLP*PSPLRRGGMPPK 483 ++N + +P P P+ G PP+ Sbjct: 117 IINIEQIPVPVPIYCGNFPPR 137 >DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 8.2 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = -3 Query: 545 LVNYKFLP*PSPLRRGGMPPK 483 ++N + +P P P+ G PP+ Sbjct: 113 IINIEQIPVPVPIYCGNFPPR 133 >DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex determiner protein. Length = 178 Score = 21.8 bits (44), Expect = 8.2 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = -3 Query: 545 LVNYKFLP*PSPLRRGGMPPK 483 ++N + +P P P+ G PP+ Sbjct: 110 IINIEQIPVPVPIYCGNFPPR 130 >DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 21.8 bits (44), Expect = 8.2 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = -3 Query: 545 LVNYKFLP*PSPLRRGGMPPK 483 ++N + +P P P+ G PP+ Sbjct: 121 IINIEQIPVPVPVYYGNFPPR 141 >DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. Length = 552 Score = 21.8 bits (44), Expect = 8.2 Identities = 8/26 (30%), Positives = 16/26 (61%) Frame = -3 Query: 92 SGLVRCAVDQCQRIYLLRVDKSESSK 15 + + R VD+C R+++L K + +K Sbjct: 246 TSVFRIQVDECDRLWILDSGKVDIAK 271 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 21.8 bits (44), Expect = 8.2 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = -3 Query: 545 LVNYKFLP*PSPLRRGGMPPK 483 ++N + +P P P+ G PP+ Sbjct: 338 IINIEQIPVPVPIYCGNFPPR 358 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 21.8 bits (44), Expect = 8.2 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = -3 Query: 545 LVNYKFLP*PSPLRRGGMPPK 483 ++N + +P P P+ G PP+ Sbjct: 351 IINIEQIPVPVPIYCGNFPPR 371 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 21.8 bits (44), Expect = 8.2 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = -3 Query: 545 LVNYKFLP*PSPLRRGGMPPK 483 ++N + +P P P+ G PP+ Sbjct: 346 IINIEQIPVPVPVYYGNFPPR 366 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 228,004 Number of Sequences: 438 Number of extensions: 4998 Number of successful extensions: 28 Number of sequences better than 10.0: 25 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27188448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -