BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0090 (426 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g56750.1 68418.m07083 Ndr family protein similar to SP|O23969... 42 1e-04 At2g19620.1 68415.m02292 Ndr family protein similar to SP|O23969... 39 0.001 At5g11790.1 68418.m01376 Ndr family protein similar to SP|O23969... 32 0.19 At4g28990.1 68417.m04143 RNA-binding protein-related contains we... 28 2.3 At2g19400.1 68415.m02263 protein kinase, putative contains prote... 27 5.3 At3g26780.1 68416.m03350 phosphoglycerate/bisphosphoglycerate mu... 27 7.0 At3g14890.2 68416.m01883 phosphoesterase identical to phosphoest... 26 9.3 At3g14890.1 68416.m01882 phosphoesterase identical to phosphoest... 26 9.3 >At5g56750.1 68418.m07083 Ndr family protein similar to SP|O23969 Pollen specific protein SF21 {Helianthus annuus}; contains Pfam profile PF03096: Ndr family Length = 346 Score = 42.3 bits (95), Expect = 1e-04 Identities = 22/64 (34%), Positives = 32/64 (50%) Frame = +3 Query: 3 GANVLARFALIHPXKVDALTLINCTSNQAGWIEWAYQKMNTRSLRSRGMTQGVLDYLLWH 182 GA +L FA+ H +V L L++ W EW Y K+ T L GM V ++LL Sbjct: 128 GAYILTLFAMKHRERVLGLILVSPLCKAPSWSEWFYNKVITNLLYYYGMCGVVKEFLLQR 187 Query: 183 HFGR 194 +F + Sbjct: 188 YFSK 191 >At2g19620.1 68415.m02292 Ndr family protein similar to SP|O23969 Pollen specific protein SF21 {Helianthus annuus}; contains Pfam profile PF03096: Ndr family Length = 347 Score = 39.1 bits (87), Expect = 0.001 Identities = 21/64 (32%), Positives = 32/64 (50%) Frame = +3 Query: 3 GANVLARFALIHPXKVDALTLINCTSNQAGWIEWAYQKMNTRSLRSRGMTQGVLDYLLWH 182 GA +L+ FA+ H +V L LI+ W EW Y K+ + L GM+ + D L Sbjct: 128 GAYILSLFAIKHKERVLGLILISPLCKAPSWSEWFYYKVVSNLLYYYGMSGLLKDIFLQR 187 Query: 183 HFGR 194 +F + Sbjct: 188 YFSK 191 >At5g11790.1 68418.m01376 Ndr family protein similar to SP|O23969 Pollen specific protein SF21 {Helianthus annuus}; contains Pfam profile PF03096: Ndr family Length = 344 Score = 31.9 bits (69), Expect = 0.19 Identities = 19/71 (26%), Positives = 30/71 (42%) Frame = +3 Query: 3 GANVLARFALIHPXKVDALTLINCTSNQAGWIEWAYQKMNTRSLRSRGMTQGVLDYLLWH 182 GA +L FA+ + +V L L++ W EW K+ + L G V + LL Sbjct: 128 GAYILTLFAMKYRQRVLGLILVSPLCQAPSWSEWLCNKVMSNLLYYYGTCGVVKEMLLKR 187 Query: 183 HFGRFPEDRNH 215 +F + H Sbjct: 188 YFSKEVRGNGH 198 >At4g28990.1 68417.m04143 RNA-binding protein-related contains weak similarity to Swiss-Prot:Q01844 RNA-binding protein EWS (EWS oncogene)(Ewing sarcoma breakpoint region 1 protein) [Homo sapiens] Length = 347 Score = 28.3 bits (60), Expect = 2.3 Identities = 16/42 (38%), Positives = 20/42 (47%) Frame = -1 Query: 222 SDRGCGLRGNVRNDATKGSPARPGSCHGNEGTECSSSGKPTR 97 SDR G G R A+ SP R G G++ + SG P R Sbjct: 55 SDRYKGDNGGHRTRASSSSPGRRGYEDHKHGSDLNHSGVPPR 96 >At2g19400.1 68415.m02263 protein kinase, putative contains protein kinase domain, Pfam:PF00069 Length = 527 Score = 27.1 bits (57), Expect = 5.3 Identities = 11/43 (25%), Positives = 21/43 (48%) Frame = +2 Query: 245 HT*LNPSNLSMFIEAYVXRSDLGICRNADTIKVPVLNITGALS 373 H + P NL + ++ SD G+C+ D + +N+ L+ Sbjct: 226 HRDIKPDNLLLDKYGHMKLSDFGLCKPLDCRNISAMNVNEPLN 268 >At3g26780.1 68416.m03350 phosphoglycerate/bisphosphoglycerate mutase family protein similar to X4 protein GI:21386798, Y4 protein GI:21386800 from [Silene dioica]; contains Pfam profiles PF00300: phosphoglycerate mutase family, PF01535: PPR repeat Length = 1053 Score = 26.6 bits (56), Expect = 7.0 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +1 Query: 346 GVEHHGCSVTSRRRHGYLQR 405 G+EH+GC V R G+LQ+ Sbjct: 817 GLEHYGCMVDLLGRAGFLQK 836 >At3g14890.2 68416.m01883 phosphoesterase identical to phosphoesterase [Arabidopsis thaliana] GI:21630064; contains Pfam profile PF00645: Poly(ADP-ribose) polymerase and DNA-Ligase Zn-finger region Length = 638 Score = 26.2 bits (55), Expect = 9.3 Identities = 15/35 (42%), Positives = 20/35 (57%), Gaps = 4/35 (11%) Frame = +3 Query: 114 KMNTRSLR----SRGMTQGVLDYLLWHHFGRFPED 206 K+ +SLR S+G +G +D WHHF FP D Sbjct: 21 KIAVKSLRLGLISKG--RGGVDMTRWHHFDCFPTD 53 >At3g14890.1 68416.m01882 phosphoesterase identical to phosphoesterase [Arabidopsis thaliana] GI:21630064; contains Pfam profile PF00645: Poly(ADP-ribose) polymerase and DNA-Ligase Zn-finger region Length = 694 Score = 26.2 bits (55), Expect = 9.3 Identities = 15/35 (42%), Positives = 20/35 (57%), Gaps = 4/35 (11%) Frame = +3 Query: 114 KMNTRSLR----SRGMTQGVLDYLLWHHFGRFPED 206 K+ +SLR S+G +G +D WHHF FP D Sbjct: 68 KIAVKSLRLGLISKG--RGGVDMTRWHHFDCFPTD 100 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,721,210 Number of Sequences: 28952 Number of extensions: 210084 Number of successful extensions: 556 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 545 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 556 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 665183504 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -