BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0084 (748 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 prot... 27 0.21 AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory recept... 23 2.0 DQ659252-1|ABG47450.1| 377|Tribolium castaneum chitinase 13 pro... 21 7.9 >EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 protein. Length = 475 Score = 26.6 bits (56), Expect = 0.21 Identities = 9/30 (30%), Positives = 17/30 (56%) Frame = +2 Query: 359 SSNAFRF*GWGSRFNYTETLELISQGGWRI 448 + N+ ++ G Y E +EL +GGW++ Sbjct: 284 AGNSGKYTGEAGMLGYNEIVELQKEGGWKV 313 >AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory receptor candidate 57 protein. Length = 387 Score = 23.4 bits (48), Expect = 2.0 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -3 Query: 719 TKHKDVQSVFSNIMSQSKYEIFGLCS 642 +K K ++S F+ SK EIF CS Sbjct: 84 SKGKVIKSFFNQGYELSKQEIFNCCS 109 >DQ659252-1|ABG47450.1| 377|Tribolium castaneum chitinase 13 protein. Length = 377 Score = 21.4 bits (43), Expect = 7.9 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +3 Query: 69 NDPVIGGLLESSW 107 N P+ GG+ ES W Sbjct: 215 NSPLYGGVNESDW 227 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 172,175 Number of Sequences: 336 Number of extensions: 3705 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 19923648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -