BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0084 (748 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_9343| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_27238| Best HMM Match : DUF433 (HMM E-Value=8.2) 28 7.0 >SB_9343| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 786 Score = 28.3 bits (60), Expect = 7.0 Identities = 13/44 (29%), Positives = 24/44 (54%) Frame = -1 Query: 637 VNTEATSVPTSHTLVRRPHDLTI*FNKLENYCFSFIFYCLDGWR 506 V+ ++P HT++++P DL KLEN + C++ +R Sbjct: 140 VDAVKLNLPDYHTIIKKPMDLGTIKKKLENNEYPCAQECIEDFR 183 Score = 27.9 bits (59), Expect = 9.2 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = -1 Query: 637 VNTEATSVPTSHTLVRRPHDLTI*FNKLENYCF 539 V+ EA + H ++++P D+T NKLEN + Sbjct: 345 VDAEALGLHDYHDIIKQPMDMTEIKNKLENRAY 377 >SB_27238| Best HMM Match : DUF433 (HMM E-Value=8.2) Length = 368 Score = 28.3 bits (60), Expect = 7.0 Identities = 11/25 (44%), Positives = 18/25 (72%) Frame = -1 Query: 139 KRMHRTSYPLGHDDSNRPPITGSLQ 65 KR+H+ S+ LGH+DS+ +G L+ Sbjct: 18 KRIHQVSHELGHEDSSSGSDSGYLE 42 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,203,401 Number of Sequences: 59808 Number of extensions: 455206 Number of successful extensions: 820 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 766 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 820 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2022185256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -