BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0083 (743 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 25 2.5 AJ010194-1|CAA09033.1| 684|Anopheles gambiae prophenoloxidase p... 24 4.3 AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase pr... 23 10.0 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 25.0 bits (52), Expect = 2.5 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +1 Query: 466 LLPGDSLDSVHFNMNLIRESN*STLILKEQSRE 564 +LPG + S+H M L E + L +E++RE Sbjct: 428 MLPGMGMQSIHERMKLEEEHRAARLREEERARE 460 >AJ010194-1|CAA09033.1| 684|Anopheles gambiae prophenoloxidase protein. Length = 684 Score = 24.2 bits (50), Expect = 4.3 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = -2 Query: 721 LRSSLPRTYFPKDFTSS 671 LR S+P YFPK SS Sbjct: 263 LRESIPEAYFPKIVRSS 279 >AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase protein. Length = 1253 Score = 23.0 bits (47), Expect = 10.0 Identities = 12/48 (25%), Positives = 26/48 (54%) Frame = +2 Query: 20 ENLRFKEEGVRDIVKDVFLPWYNAFRFLMQNVERLVQEDHVDYRFNEK 163 E ++ + +G+RD+ F+ F ++ ++ QE H+++ FN K Sbjct: 911 EEMKSQLKGLRDLAVFAFVMANALFVLVIFLLQLKKQELHIEWWFNVK 958 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 748,854 Number of Sequences: 2352 Number of extensions: 15050 Number of successful extensions: 24 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 76507752 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -