BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0077 (785 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory recept... 23 2.1 EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive pep... 23 2.8 >AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory receptor candidate 9 protein. Length = 408 Score = 23.4 bits (48), Expect = 2.1 Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 2/34 (5%) Frame = -1 Query: 731 LSQLIDNIIL--FVGNFEFIAISRCPSAYLHQYT 636 L + + IIL F+ NF FI S YLH+ T Sbjct: 281 LDEKLSYIILTSFLNNFYFIIFQVFESFYLHKAT 314 >EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive peptide receptor 2 protein. Length = 354 Score = 23.0 bits (47), Expect = 2.8 Identities = 9/31 (29%), Positives = 13/31 (41%) Frame = +2 Query: 338 VTRTVWPAAVHRCKXPNTPITSCTMHPSPPP 430 + RT+W + + PI C H PP Sbjct: 229 IVRTIWSKSKLLIPVGHIPIRQCDDHRDRPP 259 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 186,229 Number of Sequences: 336 Number of extensions: 4056 Number of successful extensions: 13 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21272645 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -