BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0072 (621 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X06272-1|CAA29608.1| 638|Homo sapiens protein ( Human mRNA for ... 94 4e-19 CR457025-1|CAG33306.1| 638|Homo sapiens SRPR protein. 94 4e-19 BC013583-1|AAH13583.1| 638|Homo sapiens signal recognition part... 94 4e-19 BC009110-1|AAH09110.1| 638|Homo sapiens signal recognition part... 94 4e-19 BC001162-1|AAH01162.1| 638|Homo sapiens signal recognition part... 94 4e-19 BC132871-1|AAI32872.1| 745|Homo sapiens cutaneous T-cell lympho... 33 1.1 BC031065-1|AAH31065.2| 780|Homo sapiens CTAGE1 protein protein. 33 1.1 AF273058-1|AAK63198.1| 754|Homo sapiens CTAGE-2 protein. 33 1.1 BC033798-1|AAH33798.1| 430|Homo sapiens spermatogenic leucine z... 32 1.9 AK098575-1|BAC05340.1| 382|Homo sapiens protein ( Homo sapiens ... 32 1.9 AF333098-1|AAK17995.1| 430|Homo sapiens testis-specific protein... 32 1.9 L34688-1|AAB00324.1| 136|Homo sapiens C219-reactive peptide pro... 30 5.7 D87742-1|BAA13448.1| 1193|Homo sapiens KIAA0268 protein. 30 5.7 AL592148-11|CAI40473.1| 785|Homo sapiens C219-reactive peptide ... 30 5.7 AL592148-9|CAI40471.1| 1015|Homo sapiens C219-reactive peptide (... 30 5.7 AL592148-7|CAI40469.1| 1907|Homo sapiens C219-reactive peptide (... 30 5.7 AK096526-1|BAC04810.1| 941|Homo sapiens protein ( Homo sapiens ... 30 5.7 U94780-1|AAB86593.1| 804|Homo sapiens MEA6 protein. 30 7.6 U73682-1|AAB86589.1| 776|Homo sapiens meningioma-expressed anti... 30 7.6 BC064355-1|AAH64355.1| 809|Homo sapiens CTAGE5 protein protein. 30 7.6 BC051363-1|AAH51363.2| 729|Homo sapiens CTAGE family, member 5 ... 30 7.6 BC039017-1|AAH39017.1| 309|Homo sapiens CTAGE5 protein protein. 30 7.6 BC029513-1|AAH29513.1| 395|Homo sapiens CTAGE5 protein protein. 30 7.6 AK055791-1|BAB71015.1| 365|Homo sapiens protein ( Homo sapiens ... 30 7.6 AF338234-1|AAN77611.1| 771|Homo sapiens CTAGE-5B protein protein. 30 7.6 AF338233-1|AAN77610.1| 775|Homo sapiens CTAGE-5A protein protein. 30 7.6 AF338231-1|AAN77608.1| 158|Homo sapiens CTAGE-3 protein protein. 30 7.6 AB209528-1|BAD92765.1| 808|Homo sapiens CTAGE family, member 5 ... 30 7.6 >X06272-1|CAA29608.1| 638|Homo sapiens protein ( Human mRNA for docking protein (signal recognition particle receptor). ). Length = 638 Score = 93.9 bits (223), Expect = 4e-19 Identities = 42/59 (71%), Positives = 49/59 (83%) Frame = +1 Query: 76 MLDLFSIFSKGGIVLWCFQSTSEIFSPSVNALIRSVILQERSGNNTFNHNALTLQYKLD 252 MLD F+IFSKGG+VLWCFQ S+ + VNALIRSV+LQER GNN+F H ALTL+YKLD Sbjct: 1 MLDFFTIFSKGGLVLWCFQGVSDSCTGPVNALIRSVLLQERGGNNSFTHEALTLKYKLD 59 Score = 79.8 bits (188), Expect = 7e-15 Identities = 40/89 (44%), Positives = 60/89 (67%), Gaps = 4/89 (4%) Frame = +3 Query: 255 EFELVFVVAYQRILQLSYVDKFLNDVHLEFRDKYKNELQTGPCIV----DFNFKTTFDKV 422 +FELVFVV +Q+IL L+YVD+ ++DVH FRDKY+ E+Q + F+F+ F ++ Sbjct: 61 QFELVFVVGFQKILTLTYVDRLIDDVHRLFRDKYRTEIQQQSALSLLNGTFDFQNDFLRL 120 Query: 423 LKECEIWAKSQAKIPKQMRTFEDSQKSKK 509 L+E E S+ + P M+ FEDS+K+KK Sbjct: 121 LREAE--ESSKIRAPTTMKKFEDSEKAKK 147 >CR457025-1|CAG33306.1| 638|Homo sapiens SRPR protein. Length = 638 Score = 93.9 bits (223), Expect = 4e-19 Identities = 42/59 (71%), Positives = 49/59 (83%) Frame = +1 Query: 76 MLDLFSIFSKGGIVLWCFQSTSEIFSPSVNALIRSVILQERSGNNTFNHNALTLQYKLD 252 MLD F+IFSKGG+VLWCFQ S+ + VNALIRSV+LQER GNN+F H ALTL+YKLD Sbjct: 1 MLDFFTIFSKGGLVLWCFQGVSDSCTGPVNALIRSVLLQERGGNNSFTHEALTLKYKLD 59 Score = 81.0 bits (191), Expect = 3e-15 Identities = 41/89 (46%), Positives = 60/89 (67%), Gaps = 4/89 (4%) Frame = +3 Query: 255 EFELVFVVAYQRILQLSYVDKFLNDVHLEFRDKYKNELQTGPCIV----DFNFKTTFDKV 422 +FELVFVV +Q+IL L+YVDK ++DVH FRDKY+ E+Q + F+F+ F ++ Sbjct: 61 QFELVFVVGFQKILTLTYVDKLIDDVHRLFRDKYRTEIQQQSALSLLNGTFDFQNDFLRL 120 Query: 423 LKECEIWAKSQAKIPKQMRTFEDSQKSKK 509 L+E E S+ + P M+ FEDS+K+KK Sbjct: 121 LREAE--ESSKIRAPTTMKKFEDSEKAKK 147 >BC013583-1|AAH13583.1| 638|Homo sapiens signal recognition particle receptor ('docking protein') protein. Length = 638 Score = 93.9 bits (223), Expect = 4e-19 Identities = 42/59 (71%), Positives = 49/59 (83%) Frame = +1 Query: 76 MLDLFSIFSKGGIVLWCFQSTSEIFSPSVNALIRSVILQERSGNNTFNHNALTLQYKLD 252 MLD F+IFSKGG+VLWCFQ S+ + VNALIRSV+LQER GNN+F H ALTL+YKLD Sbjct: 1 MLDFFTIFSKGGLVLWCFQGVSDSCTGPVNALIRSVLLQERGGNNSFTHEALTLKYKLD 59 Score = 81.0 bits (191), Expect = 3e-15 Identities = 41/89 (46%), Positives = 60/89 (67%), Gaps = 4/89 (4%) Frame = +3 Query: 255 EFELVFVVAYQRILQLSYVDKFLNDVHLEFRDKYKNELQTGPCIV----DFNFKTTFDKV 422 +FELVFVV +Q+IL L+YVDK ++DVH FRDKY+ E+Q + F+F+ F ++ Sbjct: 61 QFELVFVVGFQKILTLTYVDKLIDDVHRLFRDKYRTEIQQQSALSLLNGTFDFQNDFLRL 120 Query: 423 LKECEIWAKSQAKIPKQMRTFEDSQKSKK 509 L+E E S+ + P M+ FEDS+K+KK Sbjct: 121 LREAE--ESSKIRAPTTMKKFEDSEKAKK 147 >BC009110-1|AAH09110.1| 638|Homo sapiens signal recognition particle receptor ('docking protein') protein. Length = 638 Score = 93.9 bits (223), Expect = 4e-19 Identities = 42/59 (71%), Positives = 49/59 (83%) Frame = +1 Query: 76 MLDLFSIFSKGGIVLWCFQSTSEIFSPSVNALIRSVILQERSGNNTFNHNALTLQYKLD 252 MLD F+IFSKGG+VLWCFQ S+ + VNALIRSV+LQER GNN+F H ALTL+YKLD Sbjct: 1 MLDFFTIFSKGGLVLWCFQGVSDSCTGPVNALIRSVLLQERGGNNSFTHEALTLKYKLD 59 Score = 81.0 bits (191), Expect = 3e-15 Identities = 41/89 (46%), Positives = 60/89 (67%), Gaps = 4/89 (4%) Frame = +3 Query: 255 EFELVFVVAYQRILQLSYVDKFLNDVHLEFRDKYKNELQTGPCIV----DFNFKTTFDKV 422 +FELVFVV +Q+IL L+YVDK ++DVH FRDKY+ E+Q + F+F+ F ++ Sbjct: 61 QFELVFVVGFQKILTLTYVDKLIDDVHRLFRDKYRTEIQQQSALSLLNGTFDFQNDFLRL 120 Query: 423 LKECEIWAKSQAKIPKQMRTFEDSQKSKK 509 L+E E S+ + P M+ FEDS+K+KK Sbjct: 121 LREAE--ESSKIRAPTTMKKFEDSEKAKK 147 >BC001162-1|AAH01162.1| 638|Homo sapiens signal recognition particle receptor ('docking protein') protein. Length = 638 Score = 93.9 bits (223), Expect = 4e-19 Identities = 42/59 (71%), Positives = 49/59 (83%) Frame = +1 Query: 76 MLDLFSIFSKGGIVLWCFQSTSEIFSPSVNALIRSVILQERSGNNTFNHNALTLQYKLD 252 MLD F+IFSKGG+VLWCFQ S+ + VNALIRSV+LQER GNN+F H ALTL+YKLD Sbjct: 1 MLDFFTIFSKGGLVLWCFQGVSDSCTGPVNALIRSVLLQERGGNNSFTHEALTLKYKLD 59 Score = 81.0 bits (191), Expect = 3e-15 Identities = 41/89 (46%), Positives = 60/89 (67%), Gaps = 4/89 (4%) Frame = +3 Query: 255 EFELVFVVAYQRILQLSYVDKFLNDVHLEFRDKYKNELQTGPCIV----DFNFKTTFDKV 422 +FELVFVV +Q+IL L+YVDK ++DVH FRDKY+ E+Q + F+F+ F ++ Sbjct: 61 QFELVFVVGFQKILTLTYVDKLIDDVHRLFRDKYRTEIQQQSALSLLNGTFDFQNDFLRL 120 Query: 423 LKECEIWAKSQAKIPKQMRTFEDSQKSKK 509 L+E E S+ + P M+ FEDS+K+KK Sbjct: 121 LREAE--ESSKIRAPTTMKKFEDSEKAKK 147 >BC132871-1|AAI32872.1| 745|Homo sapiens cutaneous T-cell lymphoma-associated antigen 1 protein. Length = 745 Score = 32.7 bits (71), Expect = 1.1 Identities = 12/27 (44%), Positives = 21/27 (77%) Frame = +3 Query: 417 KVLKECEIWAKSQAKIPKQMRTFEDSQ 497 ++L+E E+W + +++ KQ RTFEDS+ Sbjct: 194 QLLQEAEVWKEQVSELIKQKRTFEDSK 220 >BC031065-1|AAH31065.2| 780|Homo sapiens CTAGE1 protein protein. Length = 780 Score = 32.7 bits (71), Expect = 1.1 Identities = 12/27 (44%), Positives = 21/27 (77%) Frame = +3 Query: 417 KVLKECEIWAKSQAKIPKQMRTFEDSQ 497 ++L+E E+W + +++ KQ RTFEDS+ Sbjct: 229 QLLQEAEVWKEQVSELIKQKRTFEDSK 255 >AF273058-1|AAK63198.1| 754|Homo sapiens CTAGE-2 protein. Length = 754 Score = 32.7 bits (71), Expect = 1.1 Identities = 12/27 (44%), Positives = 21/27 (77%) Frame = +3 Query: 417 KVLKECEIWAKSQAKIPKQMRTFEDSQ 497 ++L+E E+W + +++ KQ RTFEDS+ Sbjct: 194 QLLQEAEVWKEQVSELIKQKRTFEDSK 220 >BC033798-1|AAH33798.1| 430|Homo sapiens spermatogenic leucine zipper 1 protein. Length = 430 Score = 31.9 bits (69), Expect = 1.9 Identities = 16/62 (25%), Positives = 33/62 (53%) Frame = +3 Query: 315 KFLNDVHLEFRDKYKNELQTGPCIVDFNFKTTFDKVLKECEIWAKSQAKIPKQMRTFEDS 494 K LN+ + ++K KN L + +++L+E E W+K ++ K +++++ S Sbjct: 218 KVLNETQ-QSQEKAKNRLNVQE--ETMKIRNNMEQLLQEAEHWSKQHTELSKLIKSYQKS 274 Query: 495 QK 500 QK Sbjct: 275 QK 276 >AK098575-1|BAC05340.1| 382|Homo sapiens protein ( Homo sapiens cDNA FLJ25709 fis, clone TST04944. ). Length = 382 Score = 31.9 bits (69), Expect = 1.9 Identities = 16/62 (25%), Positives = 33/62 (53%) Frame = +3 Query: 315 KFLNDVHLEFRDKYKNELQTGPCIVDFNFKTTFDKVLKECEIWAKSQAKIPKQMRTFEDS 494 K LN+ + ++K KN L + +++L+E E W+K ++ K +++++ S Sbjct: 170 KVLNETQ-QSQEKAKNRLNVQE--ETMKIRNNMEQLLQEAEHWSKQHTELSKLIKSYQKS 226 Query: 495 QK 500 QK Sbjct: 227 QK 228 >AF333098-1|AAK17995.1| 430|Homo sapiens testis-specific protein NYD-TSP1 protein. Length = 430 Score = 31.9 bits (69), Expect = 1.9 Identities = 16/62 (25%), Positives = 33/62 (53%) Frame = +3 Query: 315 KFLNDVHLEFRDKYKNELQTGPCIVDFNFKTTFDKVLKECEIWAKSQAKIPKQMRTFEDS 494 K LN+ + ++K KN L + +++L+E E W+K ++ K +++++ S Sbjct: 218 KVLNETQ-QSQEKAKNRLNVQE--ETMKIRNNMEQLLQEAEHWSKQHTELSKLIKSYQKS 274 Query: 495 QK 500 QK Sbjct: 275 QK 276 >L34688-1|AAB00324.1| 136|Homo sapiens C219-reactive peptide protein. Length = 136 Score = 30.3 bits (65), Expect = 5.7 Identities = 20/68 (29%), Positives = 36/68 (52%) Frame = +3 Query: 297 QLSYVDKFLNDVHLEFRDKYKNELQTGPCIVDFNFKTTFDKVLKECEIWAKSQAKIPKQM 476 + S V LN+ L +K K+E + K +++ +E E W+K A++ +Q+ Sbjct: 19 EFSEVQIALNEAKLS-EEKVKSECHRVQ-EENARLKKKKEQLQQEIEDWSKLHAELSEQI 76 Query: 477 RTFEDSQK 500 ++FE SQK Sbjct: 77 KSFEKSQK 84 >D87742-1|BAA13448.1| 1193|Homo sapiens KIAA0268 protein. Length = 1193 Score = 30.3 bits (65), Expect = 5.7 Identities = 20/68 (29%), Positives = 36/68 (52%) Frame = +3 Query: 297 QLSYVDKFLNDVHLEFRDKYKNELQTGPCIVDFNFKTTFDKVLKECEIWAKSQAKIPKQM 476 + S V LN+ L +K K+E + K +++ +E E W+K A++ +Q+ Sbjct: 610 EFSEVQIALNEAKLS-EEKVKSECHRVQ-EENARLKKKKEQLQQEIEDWSKLHAELSEQI 667 Query: 477 RTFEDSQK 500 ++FE SQK Sbjct: 668 KSFEKSQK 675 >AL592148-11|CAI40473.1| 785|Homo sapiens C219-reactive peptide (FLJ39207) protein. Length = 785 Score = 30.3 bits (65), Expect = 5.7 Identities = 20/68 (29%), Positives = 36/68 (52%) Frame = +3 Query: 297 QLSYVDKFLNDVHLEFRDKYKNELQTGPCIVDFNFKTTFDKVLKECEIWAKSQAKIPKQM 476 + S V LN+ L +K K+E + K +++ +E E W+K A++ +Q+ Sbjct: 202 EFSEVQIALNEAKLS-EEKVKSECHRVQ-EENARLKKKKEQLQQEIEDWSKLHAELSEQI 259 Query: 477 RTFEDSQK 500 ++FE SQK Sbjct: 260 KSFEKSQK 267 >AL592148-9|CAI40471.1| 1015|Homo sapiens C219-reactive peptide (FLJ39207) protein. Length = 1015 Score = 30.3 bits (65), Expect = 5.7 Identities = 12/29 (41%), Positives = 21/29 (72%) Frame = +3 Query: 414 DKVLKECEIWAKSQAKIPKQMRTFEDSQK 500 D + +E E W+K A++ +Q+++FE SQK Sbjct: 884 DLLQQEIEDWSKLHAELSEQIKSFEKSQK 912 >AL592148-7|CAI40469.1| 1907|Homo sapiens C219-reactive peptide (FLJ39207) protein. Length = 1907 Score = 30.3 bits (65), Expect = 5.7 Identities = 20/68 (29%), Positives = 36/68 (52%) Frame = +3 Query: 297 QLSYVDKFLNDVHLEFRDKYKNELQTGPCIVDFNFKTTFDKVLKECEIWAKSQAKIPKQM 476 + S V LN+ L +K K+E + K +++ +E E W+K A++ +Q+ Sbjct: 1324 EFSEVQIALNEAKLS-EEKVKSECHRVQ-EENARLKKKKEQLQQEIEDWSKLHAELSEQI 1381 Query: 477 RTFEDSQK 500 ++FE SQK Sbjct: 1382 KSFEKSQK 1389 >AK096526-1|BAC04810.1| 941|Homo sapiens protein ( Homo sapiens cDNA FLJ39207 fis, clone OCBBF2005956. ). Length = 941 Score = 30.3 bits (65), Expect = 5.7 Identities = 12/29 (41%), Positives = 21/29 (72%) Frame = +3 Query: 414 DKVLKECEIWAKSQAKIPKQMRTFEDSQK 500 D + +E E W+K A++ +Q+++FE SQK Sbjct: 810 DLLQQEIEDWSKLHAELSEQIKSFEKSQK 838 >U94780-1|AAB86593.1| 804|Homo sapiens MEA6 protein. Length = 804 Score = 29.9 bits (64), Expect = 7.6 Identities = 11/27 (40%), Positives = 20/27 (74%) Frame = +3 Query: 417 KVLKECEIWAKSQAKIPKQMRTFEDSQ 497 ++L+E E+W + +++ KQ TFEDS+ Sbjct: 224 QLLQEAEVWKEQVSELNKQKVTFEDSK 250 >U73682-1|AAB86589.1| 776|Homo sapiens meningioma-expressed antigen 11 protein. Length = 776 Score = 29.9 bits (64), Expect = 7.6 Identities = 11/27 (40%), Positives = 20/27 (74%) Frame = +3 Query: 417 KVLKECEIWAKSQAKIPKQMRTFEDSQ 497 ++L+E E+W + +++ KQ TFEDS+ Sbjct: 239 QLLQEAEVWKEQVSELNKQKVTFEDSK 265 >BC064355-1|AAH64355.1| 809|Homo sapiens CTAGE5 protein protein. Length = 809 Score = 29.9 bits (64), Expect = 7.6 Identities = 11/27 (40%), Positives = 20/27 (74%) Frame = +3 Query: 417 KVLKECEIWAKSQAKIPKQMRTFEDSQ 497 ++L+E E+W + +++ KQ TFEDS+ Sbjct: 229 QLLQEAEVWKEQVSELNKQKVTFEDSK 255 >BC051363-1|AAH51363.2| 729|Homo sapiens CTAGE family, member 5 protein. Length = 729 Score = 29.9 bits (64), Expect = 7.6 Identities = 11/27 (40%), Positives = 20/27 (74%) Frame = +3 Query: 417 KVLKECEIWAKSQAKIPKQMRTFEDSQ 497 ++L+E E+W + +++ KQ TFEDS+ Sbjct: 149 QLLQEAEVWKEQVSELNKQKVTFEDSK 175 >BC039017-1|AAH39017.1| 309|Homo sapiens CTAGE5 protein protein. Length = 309 Score = 29.9 bits (64), Expect = 7.6 Identities = 11/27 (40%), Positives = 20/27 (74%) Frame = +3 Query: 417 KVLKECEIWAKSQAKIPKQMRTFEDSQ 497 ++L+E E+W + +++ KQ TFEDS+ Sbjct: 224 QLLQEAEVWKEQVSELNKQKVTFEDSK 250 >BC029513-1|AAH29513.1| 395|Homo sapiens CTAGE5 protein protein. Length = 395 Score = 29.9 bits (64), Expect = 7.6 Identities = 11/27 (40%), Positives = 20/27 (74%) Frame = +3 Query: 417 KVLKECEIWAKSQAKIPKQMRTFEDSQ 497 ++L+E E+W + +++ KQ TFEDS+ Sbjct: 224 QLLQEAEVWKEQVSELNKQKVTFEDSK 250 >AK055791-1|BAB71015.1| 365|Homo sapiens protein ( Homo sapiens cDNA FLJ31229 fis, clone KIDNE2004519, highly similar to Human meningioma-expressed antigen 11 (MEA11) mRNA. ). Length = 365 Score = 29.9 bits (64), Expect = 7.6 Identities = 11/27 (40%), Positives = 20/27 (74%) Frame = +3 Query: 417 KVLKECEIWAKSQAKIPKQMRTFEDSQ 497 ++L+E E+W + +++ KQ TFEDS+ Sbjct: 200 QLLQEAEVWKEQVSELNKQKVTFEDSK 226 >AF338234-1|AAN77611.1| 771|Homo sapiens CTAGE-5B protein protein. Length = 771 Score = 29.9 bits (64), Expect = 7.6 Identities = 11/27 (40%), Positives = 20/27 (74%) Frame = +3 Query: 417 KVLKECEIWAKSQAKIPKQMRTFEDSQ 497 ++L+E E+W + +++ KQ TFEDS+ Sbjct: 224 QLLQEAEVWKEQVSELNKQKVTFEDSK 250 >AF338233-1|AAN77610.1| 775|Homo sapiens CTAGE-5A protein protein. Length = 775 Score = 29.9 bits (64), Expect = 7.6 Identities = 11/27 (40%), Positives = 20/27 (74%) Frame = +3 Query: 417 KVLKECEIWAKSQAKIPKQMRTFEDSQ 497 ++L+E E+W + +++ KQ TFEDS+ Sbjct: 195 QLLQEAEVWKEQVSELNKQKVTFEDSK 221 >AF338231-1|AAN77608.1| 158|Homo sapiens CTAGE-3 protein protein. Length = 158 Score = 29.9 bits (64), Expect = 7.6 Identities = 11/27 (40%), Positives = 20/27 (74%) Frame = +3 Query: 417 KVLKECEIWAKSQAKIPKQMRTFEDSQ 497 ++L+E E+W + +++ KQ TFEDS+ Sbjct: 33 QLLQEAEVWKEQVSELNKQKITFEDSK 59 >AB209528-1|BAD92765.1| 808|Homo sapiens CTAGE family, member 5 isoform 1 variant protein. Length = 808 Score = 29.9 bits (64), Expect = 7.6 Identities = 11/27 (40%), Positives = 20/27 (74%) Frame = +3 Query: 417 KVLKECEIWAKSQAKIPKQMRTFEDSQ 497 ++L+E E+W + +++ KQ TFEDS+ Sbjct: 228 QLLQEAEVWKEQVSELNKQKVTFEDSK 254 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 82,643,144 Number of Sequences: 237096 Number of extensions: 1690026 Number of successful extensions: 3146 Number of sequences better than 10.0: 28 Number of HSP's better than 10.0 without gapping: 3012 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3146 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 6691573490 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -