BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0071 (513 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U97189-4|AAC48167.3| 2322|Caenorhabditis elegans Suppressor with... 30 1.1 U97189-3|AAT68901.1| 2019|Caenorhabditis elegans Suppressor with... 30 1.1 AF149821-1|AAD48773.1| 2322|Caenorhabditis elegans nonsense-medi... 30 1.1 AL132859-6|CAB60493.3| 324|Caenorhabditis elegans Hypothetical ... 27 7.9 >U97189-4|AAC48167.3| 2322|Caenorhabditis elegans Suppressor with morphological effecton genitalia protein 1, isoform a protein. Length = 2322 Score = 29.9 bits (64), Expect = 1.1 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = -2 Query: 488 LERKINNFGQKSWKLTVQLTSSDVH 414 L++ INNFG K WK T + SS +H Sbjct: 547 LQKIINNFGDKLWKKTRLMISSWLH 571 >U97189-3|AAT68901.1| 2019|Caenorhabditis elegans Suppressor with morphological effecton genitalia protein 1, isoform b protein. Length = 2019 Score = 29.9 bits (64), Expect = 1.1 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = -2 Query: 488 LERKINNFGQKSWKLTVQLTSSDVH 414 L++ INNFG K WK T + SS +H Sbjct: 547 LQKIINNFGDKLWKKTRLMISSWLH 571 >AF149821-1|AAD48773.1| 2322|Caenorhabditis elegans nonsense-mediated mRNA decay proteinSMG-1 protein. Length = 2322 Score = 29.9 bits (64), Expect = 1.1 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = -2 Query: 488 LERKINNFGQKSWKLTVQLTSSDVH 414 L++ INNFG K WK T + SS +H Sbjct: 547 LQKIINNFGDKLWKKTRLMISSWLH 571 >AL132859-6|CAB60493.3| 324|Caenorhabditis elegans Hypothetical protein Y39C12A.7 protein. Length = 324 Score = 27.1 bits (57), Expect = 7.9 Identities = 16/56 (28%), Positives = 25/56 (44%) Frame = -3 Query: 388 NSITIQHELKTY*LLCCCVVRCTNSALWYPKRQFVNTYSWCINXXXXXXXLVFVSR 221 N+ T QHE K L V+C++ A+ P Q T+ +N V+ S+ Sbjct: 254 NNTTWQHEFKKCLKLYTSEVKCSSLAIGKPSLQLKTTFGERMNVGKNVQTDVYFSQ 309 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,638,218 Number of Sequences: 27780 Number of extensions: 155356 Number of successful extensions: 373 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 370 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 373 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 985905834 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -