BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0069 (678 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q21IU7 Cluster: Putative uncharacterized protein; n=1; ... 33 4.8 UniRef50_Q4YFU8 Cluster: Putative uncharacterized protein; n=1; ... 33 6.4 >UniRef50_Q21IU7 Cluster: Putative uncharacterized protein; n=1; Saccharophagus degradans 2-40|Rep: Putative uncharacterized protein - Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) Length = 168 Score = 33.5 bits (73), Expect = 4.8 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = -1 Query: 378 YSQLLKSCHCKRTVFFFFYYCFDEISIGTRFCDDRFYELM 259 YS LK C TVFF Y C+++++IG C Y L+ Sbjct: 34 YSSTLKKCGDGLTVFFGAYICYEDVAIGND-CTIEEYSLL 72 >UniRef50_Q4YFU8 Cluster: Putative uncharacterized protein; n=1; Plasmodium berghei|Rep: Putative uncharacterized protein - Plasmodium berghei Length = 85 Score = 33.1 bits (72), Expect = 6.4 Identities = 16/43 (37%), Positives = 26/43 (60%) Frame = -3 Query: 517 KFYFIKTKRKQWNNYDIKIYQNVFHLTLPATLISNSNRHIAKV 389 K+YF K W+N + I + +LT+ + ++ NSN HI+KV Sbjct: 25 KWYFFFLPFKYWDN--VNIINVIINLTIFSIIMKNSNIHISKV 65 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 591,183,186 Number of Sequences: 1657284 Number of extensions: 11208934 Number of successful extensions: 22973 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 22098 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22961 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 52479343733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -