BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0068 (718 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ697721-1|CAG26914.1| 135|Anopheles gambiae putative odorant-b... 25 2.3 CR954256-7|CAJ14148.1| 1087|Anopheles gambiae predicted protein ... 24 4.1 AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 24 5.4 >AJ697721-1|CAG26914.1| 135|Anopheles gambiae putative odorant-binding protein OBPjj11 protein. Length = 135 Score = 25.0 bits (52), Expect = 2.3 Identities = 15/53 (28%), Positives = 29/53 (54%), Gaps = 1/53 (1%) Frame = +2 Query: 221 GFVSCAIGTILSTAVQRSAQNWHGQGESDCLI-KTKHCDGPRGC*RNVISAQC 376 GFV G++ + + + + +GQ ++D L+ + ++ DGP C R+ QC Sbjct: 74 GFVD-QDGSVQTDELTQKLASEYGQEKADELVARCRNNDGPDACERSFRLLQC 125 >CR954256-7|CAJ14148.1| 1087|Anopheles gambiae predicted protein protein. Length = 1087 Score = 24.2 bits (50), Expect = 4.1 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +2 Query: 449 SQMPRHLISDAHEWINEIPTSLSTI*RN 532 S + RHL+SD + N P ++ + RN Sbjct: 1002 STIARHLLSDQSDPFNRSPLTMEQVKRN 1029 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 23.8 bits (49), Expect = 5.4 Identities = 15/38 (39%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = -3 Query: 464 DEAFGYLKRVIVTPAVYPRLLEFLHV-DIQSTGQKSHC 354 D +F L RV TPA P +EFL + D + HC Sbjct: 635 DASFNRLTRV--TPATIPNSIEFLFLNDNHIVHVEPHC 670 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 708,443 Number of Sequences: 2352 Number of extensions: 13532 Number of successful extensions: 23 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 72765525 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -