BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0066 (854 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 23 3.1 AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory recept... 22 5.4 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 23.0 bits (47), Expect = 3.1 Identities = 11/47 (23%), Positives = 19/47 (40%) Frame = +1 Query: 370 CEEWYHGDCINISERESKYIKNYFCDRCREEDPTLKTRFRPQKRENG 510 C+E C+++ R + C R+E K + +P NG Sbjct: 240 CQECRLKKCLSVGMRPECVVPEVQCAVKRKEKKAQKEKDKPNSTTNG 286 Score = 21.4 bits (43), Expect = 9.4 Identities = 6/11 (54%), Positives = 8/11 (72%) Frame = +3 Query: 789 EPYGPEGSVGR 821 +PY P G +GR Sbjct: 145 DPYSPNGKIGR 155 >AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory receptor candidate 9 protein. Length = 408 Score = 22.2 bits (45), Expect = 5.4 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = -1 Query: 602 TIFYYSSLGRFIFRMI 555 T++Y+ SLG I R++ Sbjct: 318 TVYYFISLGLLILRLV 333 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 179,266 Number of Sequences: 336 Number of extensions: 3724 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23659332 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -