SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= e96h0066
         (854 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CR954257-6|CAJ14157.1|  375|Anopheles gambiae RrnaAD, ribosomal ...    26   1.7  
AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein.           24   6.8  
AY301275-1|AAQ67361.1|  611|Anopheles gambiae G-protein coupled ...    23   9.0  
AJ439353-2|CAD27924.1|  612|Anopheles gambiae putative G-protein...    23   9.0  

>CR954257-6|CAJ14157.1|  375|Anopheles gambiae RrnaAD, ribosomal RNA
           adenine dimethylaseprotein.
          Length = 375

 Score = 25.8 bits (54), Expect = 1.7
 Identities = 16/40 (40%), Positives = 26/40 (65%), Gaps = 1/40 (2%)
 Frame = -1

Query: 584 SLGRFIFRMILFFPLLFS-IISTRINPFSLFCGLNLVFKV 468
           SLGR+   +++  PLLFS I ST+   + L+ G  +VF++
Sbjct: 128 SLGRYEMFLVM-SPLLFSHIASTKDAGYKLYRGGTIVFQL 166


>AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein.
          Length = 1459

 Score = 23.8 bits (49), Expect = 6.8
 Identities = 8/16 (50%), Positives = 9/16 (56%)
 Frame = -2

Query: 664  PHMHHNGHNRNPVSNP 617
            PH HHNG  R+    P
Sbjct: 1403 PHHHHNGSGRSKPPGP 1418


>AY301275-1|AAQ67361.1|  611|Anopheles gambiae G-protein coupled
           receptor protein.
          Length = 611

 Score = 23.4 bits (48), Expect = 9.0
 Identities = 8/13 (61%), Positives = 9/13 (69%)
 Frame = -2

Query: 670 TSPHMHHNGHNRN 632
           +S   HHNGH RN
Sbjct: 500 SSTFNHHNGHQRN 512


>AJ439353-2|CAD27924.1|  612|Anopheles gambiae putative G-protein
           coupled receptor protein.
          Length = 612

 Score = 23.4 bits (48), Expect = 9.0
 Identities = 8/13 (61%), Positives = 9/13 (69%)
 Frame = -2

Query: 670 TSPHMHHNGHNRN 632
           +S   HHNGH RN
Sbjct: 501 SSTFNHHNGHQRN 513


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 783,627
Number of Sequences: 2352
Number of extensions: 15195
Number of successful extensions: 33
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 30
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 32
length of database: 563,979
effective HSP length: 64
effective length of database: 413,451
effective search space used: 90959220
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -