BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0066 (854 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 25 0.89 U66709-1|AAB07515.1| 182|Apis mellifera ankyrin protein. 24 2.1 AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 23 3.6 AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 23 4.7 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 23 4.7 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 25.0 bits (52), Expect = 0.89 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -3 Query: 780 GAPSLIATAGWFRRXFNF*HKLS 712 G PS I+ G FRR +N KLS Sbjct: 542 GKPSRISKQGLFRRFYNLLGKLS 564 >U66709-1|AAB07515.1| 182|Apis mellifera ankyrin protein. Length = 182 Score = 23.8 bits (49), Expect = 2.1 Identities = 8/20 (40%), Positives = 15/20 (75%) Frame = -2 Query: 163 LAPKEVFIFYLTNFILFSNK 104 L + +F+ Y+TNFI++S + Sbjct: 136 LYEESLFVPYITNFIIYSKR 155 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 23.0 bits (47), Expect = 3.6 Identities = 10/41 (24%), Positives = 18/41 (43%) Frame = +1 Query: 370 CEEWYHGDCINISERESKYIKNYFCDRCREEDPTLKTRFRP 492 C+E C+ + R + Y C R+E+ K + +P Sbjct: 239 CQECRLKKCLTVGMRPECVVPEYQCAVKRKEEKAQKEKDKP 279 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 22.6 bits (46), Expect = 4.7 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -2 Query: 682 SHI*TSPHMHHNGHNRNP 629 SHI +PH HH+ H P Sbjct: 424 SHIHATPH-HHHSHAATP 440 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 22.6 bits (46), Expect = 4.7 Identities = 9/23 (39%), Positives = 9/23 (39%) Frame = -2 Query: 667 SPHMHHNGHNRNPVSNPGQSPQP 599 SPH R NP Q P P Sbjct: 26 SPHQSPQAPQRGSPPNPSQGPPP 48 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 209,101 Number of Sequences: 438 Number of extensions: 4337 Number of successful extensions: 12 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27552579 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -