BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0064 (703 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_35774| Best HMM Match : DSPc (HMM E-Value=1e-26) 29 4.8 SB_17147| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 >SB_35774| Best HMM Match : DSPc (HMM E-Value=1e-26) Length = 1418 Score = 28.7 bits (61), Expect = 4.8 Identities = 19/56 (33%), Positives = 27/56 (48%), Gaps = 1/56 (1%) Frame = +2 Query: 26 KQIPNQFVNSQFCINS-F*NHINLKMADEKKGENEHINLKVLGQDNAIVQFKIKKH 190 K NQ + Q CI F NLK+AD+ G + + KV A VQ +K++ Sbjct: 201 KYYENQISSDQTCIKEWFETEENLKIADDSVGISFQLFFKVRELVEAEVQMDLKQY 256 >SB_17147| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 487 Score = 28.3 bits (60), Expect = 6.4 Identities = 15/47 (31%), Positives = 25/47 (53%) Frame = +2 Query: 89 NLKMADEKKGENEHINLKVLGQDNAIVQFKIKKHTPLRKLMNAYCDR 229 ++K +DE+ GE E + K G+D A +K+ P + L + DR Sbjct: 33 DVKASDEEAGEEEDVEAKDNGEDGASDTI-VKEKKPCKSLSDLQDDR 78 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,515,542 Number of Sequences: 59808 Number of extensions: 377858 Number of successful extensions: 825 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 743 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 825 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1841633001 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -