BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0064 (703 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant r... 26 1.3 AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcript... 23 7.0 AJ302656-1|CAC35521.1| 385|Anopheles gambiae gSG1b protein prot... 23 9.3 >AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant receptor Or3 protein. Length = 411 Score = 25.8 bits (54), Expect = 1.3 Identities = 25/96 (26%), Positives = 35/96 (36%) Frame = -1 Query: 397 WSILKIIKFTLGTLLRSAVGKPLLCRPLPSQVMLECHSHLLVAHQI*MHYLH**TCSITI 218 W + + FT GT L + C + V L H VA L+ I Sbjct: 211 WPTIYTLGFTGGTKLLTIFSNVKYCSAMLKLVALRIHCLARVAQDRAEKELN-----EII 265 Query: 217 SIHQFPERCVFLYFELYNCVILT*YFQINVFVFSLL 110 S+HQ CVFL + V + Q + SL+ Sbjct: 266 SMHQRVLNCVFLLETTFRWVFFVQFIQCTMIWCSLI 301 >AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcriptase protein. Length = 1222 Score = 23.4 bits (48), Expect = 7.0 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = -1 Query: 400 RWSILKIIKFTLGTLLRSAVGKPLLCRP 317 RW I+ I ++ +R AVG+ LL RP Sbjct: 191 RWRIISIYSYSNHVYIRFAVGE-LLQRP 217 >AJ302656-1|CAC35521.1| 385|Anopheles gambiae gSG1b protein protein. Length = 385 Score = 23.0 bits (47), Expect = 9.3 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +3 Query: 384 LRIDHLQWVKINEVY 428 L +DH +W K NE Y Sbjct: 314 LLLDHFKWEKENEYY 328 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 690,074 Number of Sequences: 2352 Number of extensions: 13661 Number of successful extensions: 15 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71504505 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -