BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0062 (627 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0987 - 25060266-25060461,25061124-25063351 29 3.0 11_06_0543 + 24792110-24792229,24792316-24792521,24793770-247944... 29 4.0 06_03_0793 + 24662506-24663512,24664470-24664787,24664996-246653... 29 4.0 05_04_0033 - 17369134-17369321,17369522-17370355,17370429-17373042 27 9.2 >12_02_0987 - 25060266-25060461,25061124-25063351 Length = 807 Score = 29.1 bits (62), Expect = 3.0 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = -1 Query: 396 QRYIVSYSQLLKSCHCKRTVFFFFYYCFDEISIGTRF 286 Q +I SY+ LL C T++ F FD + + T + Sbjct: 770 QHFIASYAVLLLKEQCTNTLYMLFNVVFDSLVMDTMY 806 >11_06_0543 + 24792110-24792229,24792316-24792521,24793770-24794462, 24794538-24794717,24794793-24795084,24795166-24795375 Length = 566 Score = 28.7 bits (61), Expect = 4.0 Identities = 19/59 (32%), Positives = 29/59 (49%) Frame = +2 Query: 233 DMGIINSLNINS*KRSSQKRVPIDISSXXXXXXXXTVLLQ*HDFKSWLYETIYLCDVSI 409 D I+NSLNI + + SS++ + +S T+LL H W+ I+L D I Sbjct: 357 DPQIVNSLNIEAGEWSSEEVLNYLYTSFVKLQDMNTILLPYHFKPHWILIAIHLNDSKI 415 >06_03_0793 + 24662506-24663512,24664470-24664787,24664996-24665323, 24665465-24665887,24665960-24666252,24666332-24666605, 24666856-24667358,24667464-24667785,24667875-24668220, 24668339-24668997,24669524-24669625,24669656-24670052, 24670155-24670270,24670360-24670386 Length = 1704 Score = 28.7 bits (61), Expect = 4.0 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = -3 Query: 238 HIKNKFKGDCERFVSFFYEISSPT 167 HI+ KFK C + S FY +S T Sbjct: 777 HIQEKFKAKCRKSESVFYTVSDAT 800 >05_04_0033 - 17369134-17369321,17369522-17370355,17370429-17373042 Length = 1211 Score = 27.5 bits (58), Expect = 9.2 Identities = 13/37 (35%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = -3 Query: 247 YYPHIKNKFKGDCERFVSFFY-EISSPTSESILRLPN 140 ++PH+K+ F DC VS F ++SS ++ LP+ Sbjct: 1061 HWPHLKDIFIHDCRSSVSLFVGDLSSLKEFTLYHLPD 1097 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,518,841 Number of Sequences: 37544 Number of extensions: 239930 Number of successful extensions: 387 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 379 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 387 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1525730988 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -