BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0061 (748 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 22 4.5 AM292339-1|CAL23151.2| 387|Tribolium castaneum gustatory recept... 21 7.9 AM292338-1|CAL23150.2| 372|Tribolium castaneum gustatory recept... 21 7.9 AF265299-1|AAG17642.1| 63|Tribolium castaneum putative cytochr... 21 7.9 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 22.2 bits (45), Expect = 4.5 Identities = 9/23 (39%), Positives = 11/23 (47%) Frame = -1 Query: 568 TICCSGSKLISS*NSRVVQCGPG 500 T C +G I NS + C PG Sbjct: 30 TSCMNGGTCIDGINSYICTCKPG 52 >AM292339-1|CAL23151.2| 387|Tribolium castaneum gustatory receptor candidate 18 protein. Length = 387 Score = 21.4 bits (43), Expect = 7.9 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +1 Query: 604 YSRWSKKALQTSSF 645 YS WSKK+ Q F Sbjct: 150 YSTWSKKSKQVEYF 163 >AM292338-1|CAL23150.2| 372|Tribolium castaneum gustatory receptor candidate 17 protein. Length = 372 Score = 21.4 bits (43), Expect = 7.9 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +1 Query: 604 YSRWSKKALQTSSF 645 YS WSKK+ Q F Sbjct: 150 YSTWSKKSKQVEYF 163 >AF265299-1|AAG17642.1| 63|Tribolium castaneum putative cytochrome P450 monooxigenase protein. Length = 63 Score = 21.4 bits (43), Expect = 7.9 Identities = 9/32 (28%), Positives = 19/32 (59%) Frame = +3 Query: 522 REFQELINFDPEQQIVYLELGCGVGNMIFPLV 617 +E + ++++ Q++ YLEL ++PLV Sbjct: 32 KEKKPIVSYSDLQEMKYLELVIKEALRLYPLV 63 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 167,217 Number of Sequences: 336 Number of extensions: 3509 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 19923648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -