BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0060 (738 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC806.06c |||nicotinamide mononucleotide |Schizosaccharomyces ... 26 6.4 SPAC29B12.06c |rcd1||RNA-binding protein Rcd1 |Schizosaccharomyc... 25 8.5 >SPAC806.06c |||nicotinamide mononucleotide |Schizosaccharomyces pombe|chr 1|||Manual Length = 365 Score = 25.8 bits (54), Expect = 6.4 Identities = 12/28 (42%), Positives = 13/28 (46%), Gaps = 1/28 (3%) Frame = +3 Query: 570 YH-LRALGAWCERVGSWQAPSAWRSALP 650 YH +R CER SW AW S P Sbjct: 180 YHRVRMCELACERTSSWLMVDAWESLQP 207 >SPAC29B12.06c |rcd1||RNA-binding protein Rcd1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 283 Score = 25.4 bits (53), Expect = 8.5 Identities = 11/38 (28%), Positives = 19/38 (50%) Frame = +3 Query: 6 LCYSIPGFEITCQTSSRIYCVSDISRN*YLRRIEGTRF 119 LC + G + CQT R Y V+ + N ++ ++ F Sbjct: 182 LCDDV-GLQYICQTYERFYAVASVLNNMVMQLVDSFAF 218 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,029,874 Number of Sequences: 5004 Number of extensions: 62146 Number of successful extensions: 144 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 142 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 144 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 349251756 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -