BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0056 (548 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_01_0462 + 3422352-3422439,3423057-3423241,3423333-3423530,342... 29 2.4 10_01_0127 - 1519803-1520036,1520802-1521095,1521840-1522614,152... 28 4.3 >01_01_0462 + 3422352-3422439,3423057-3423241,3423333-3423530, 3423617-3423676,3424022-3424171 Length = 226 Score = 29.1 bits (62), Expect = 2.4 Identities = 21/65 (32%), Positives = 31/65 (47%), Gaps = 7/65 (10%) Frame = +2 Query: 125 VLGFIFVTEFLDSVAALKARDKSYAIAYKP-----KKTN--STDKKVCRYTAXYPT*XIF 283 + F FV SVA ++RD +A+K KKT S + K+C+ Y T +F Sbjct: 4 IRSFAFVLVLAFSVAVAESRDSFNVLAHKSFPLENKKTGLTSANGKLCQLCEQYSTEALF 63 Query: 284 NARQN 298 +QN Sbjct: 64 YLQQN 68 >10_01_0127 - 1519803-1520036,1520802-1521095,1521840-1522614, 1524574-1525412 Length = 713 Score = 28.3 bits (60), Expect = 4.3 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = +2 Query: 284 NARQNFL*VFFVIGHNILSVSKFCGFSKGVRGLITKL 394 +++QNF+ VF IG+ S +K CG K RG+ L Sbjct: 517 SSQQNFITVFNDIGNITCSRNKTCGLIKCDRGIYKSL 553 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,112,946 Number of Sequences: 37544 Number of extensions: 214933 Number of successful extensions: 382 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 376 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 381 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1233951264 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -