BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0055 (589 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglu... 21 5.8 EF222290-1|ABN79650.1| 378|Tribolium castaneum adipokinetic hor... 21 5.8 DQ422965-1|ABE02225.1| 378|Tribolium castaneum adipokinetic hor... 21 5.8 >EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglucosaminidase FDL protein. Length = 630 Score = 21.4 bits (43), Expect = 5.8 Identities = 14/45 (31%), Positives = 24/45 (53%) Frame = +1 Query: 385 TRLISLITLGIYKKIFGYTNKQMFLLKFHYIFTSITKLKQQINDG 519 T +ISL+ Y + T+ + FL+K + +I KLK ++G Sbjct: 136 TNIISLVQNKDY--VERDTDIRRFLIKVTILHPNIVKLKLDTSEG 178 >EF222290-1|ABN79650.1| 378|Tribolium castaneum adipokinetic hormone receptor protein. Length = 378 Score = 21.4 bits (43), Expect = 5.8 Identities = 14/59 (23%), Positives = 26/59 (44%) Frame = +3 Query: 378 WLNAIDFSNYFGDIQKNIWIH**TNVFIKVSLYFHVHHETQTTDQRWSENQKTYKYSIC 554 WL+ N IQK +++ TN + +Y + + T ++ S T K++ C Sbjct: 299 WLDRESAKNVDQRIQKALFLFACTNSCMNPVVYGVFNIRARRTGRKVSPRVNTIKHTSC 357 >DQ422965-1|ABE02225.1| 378|Tribolium castaneum adipokinetic hormone receptor protein. Length = 378 Score = 21.4 bits (43), Expect = 5.8 Identities = 14/59 (23%), Positives = 26/59 (44%) Frame = +3 Query: 378 WLNAIDFSNYFGDIQKNIWIH**TNVFIKVSLYFHVHHETQTTDQRWSENQKTYKYSIC 554 WL+ N IQK +++ TN + +Y + + T ++ S T K++ C Sbjct: 299 WLDRESAKNVDQRIQKALFLFACTNSCMNPVVYGVFNIRARRTGRKVSPRVNTIKHTSC 357 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 139,640 Number of Sequences: 336 Number of extensions: 2933 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14726181 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -