BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0055 (589 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. 24 4.2 AJ439353-5|CAD27927.1| 459|Anopheles gambiae putative G-protein... 23 5.5 >AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. Length = 1356 Score = 23.8 bits (49), Expect = 4.2 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = -3 Query: 392 NRVQPRCASRDHIYLSLAYGR 330 +R QPR D IY L Y R Sbjct: 697 SRTQPRLMDLDSIYCKLLYNR 717 >AJ439353-5|CAD27927.1| 459|Anopheles gambiae putative G-protein coupled receptor protein. Length = 459 Score = 23.4 bits (48), Expect = 5.5 Identities = 9/36 (25%), Positives = 22/36 (61%) Frame = -3 Query: 512 LICCLSFVMDVKI**NFNKNICLLVYPNIFLYIPKV 405 +IC L ++ + N++ + VYP++ +Y+P++ Sbjct: 341 IICWLPQMVSKGVDLPKNRSPAIEVYPSLLVYLPQI 376 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 593,961 Number of Sequences: 2352 Number of extensions: 11046 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 56347938 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -