BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0055 (589 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z66516-3|CAA91356.1| 79|Caenorhabditis elegans Hypothetical pr... 29 3.2 AF067946-3|AAC17682.1| 288|Caenorhabditis elegans Hypothetical ... 28 4.3 >Z66516-3|CAA91356.1| 79|Caenorhabditis elegans Hypothetical protein W03C9.5 protein. Length = 79 Score = 28.7 bits (61), Expect = 3.2 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = +3 Query: 480 HVHHETQTTDQRWSENQKTYKY 545 H H E+Q D++W+ ++K KY Sbjct: 54 HQHEESQCPDRKWNPSEKIVKY 75 >AF067946-3|AAC17682.1| 288|Caenorhabditis elegans Hypothetical protein W02G9.4 protein. Length = 288 Score = 28.3 bits (60), Expect = 4.3 Identities = 15/40 (37%), Positives = 21/40 (52%), Gaps = 5/40 (12%) Frame = +2 Query: 44 FPVQYPSRIASAVLL-IHRD----YDFVLFNNSQNFDVVA 148 FP YP I+ A L+ + D + FV FN +DVV+ Sbjct: 145 FPYNYPDNISCAFLIKVSADRLISFQFVAFNTEDGYDVVS 184 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,197,294 Number of Sequences: 27780 Number of extensions: 258836 Number of successful extensions: 569 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 560 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 569 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1237082886 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -