BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0054 (769 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ821850-1|CAH25390.1| 426|Anopheles gambiae alpha-2,6-sialyltr... 25 3.4 AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcript... 23 7.9 >AJ821850-1|CAH25390.1| 426|Anopheles gambiae alpha-2,6-sialyltransferase protein. Length = 426 Score = 24.6 bits (51), Expect = 3.4 Identities = 15/45 (33%), Positives = 24/45 (53%), Gaps = 2/45 (4%) Frame = +2 Query: 539 PPFPVHECPT--PTKAPEFQQNTKNHCLLSPSSSSLTKNHQQSFV 667 PPF +E + PT +P F T C++ S+ SL ++ SF+ Sbjct: 178 PPFTWNEIGSYLPT-SPLFGDVTNGSCVIVASAGSLKRSQLGSFI 221 >AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcriptase protein. Length = 1173 Score = 23.4 bits (48), Expect = 7.9 Identities = 11/39 (28%), Positives = 17/39 (43%) Frame = +2 Query: 554 HECPTPTKAPEFQQNTKNHCLLSPSSSSLTKNHQQSFVL 670 HE + Q + HC + SS+ T +Q + VL Sbjct: 816 HEATKNQECRRMLQRVQKHCAIKVSSAFPTVRYQTAVVL 854 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 762,593 Number of Sequences: 2352 Number of extensions: 14909 Number of successful extensions: 35 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 32 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 35 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 79834176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -