BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0054 (769 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 25 1.0 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 25 1.0 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 24.6 bits (51), Expect = 1.0 Identities = 19/65 (29%), Positives = 29/65 (44%), Gaps = 2/65 (3%) Frame = -3 Query: 458 EQRQQIVDRVAAAILDVQVGSVLQEHMDHRGPAIARG--LVKRGTVVRPDVQVNSGLYQS 285 E QQ R + ++ +V + + D R PA+A +RGTVV P + Sbjct: 857 ESIQQKAKR-SKSLQEVSSDKLQESSTDSRNPALALAEPYNQRGTVVSPPPTKRRTMKVV 915 Query: 284 LYHVF 270 YH+F Sbjct: 916 KYHLF 920 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 24.6 bits (51), Expect = 1.0 Identities = 19/65 (29%), Positives = 29/65 (44%), Gaps = 2/65 (3%) Frame = -3 Query: 458 EQRQQIVDRVAAAILDVQVGSVLQEHMDHRGPAIARG--LVKRGTVVRPDVQVNSGLYQS 285 E QQ R + ++ +V + + D R PA+A +RGTVV P + Sbjct: 895 ESIQQKAKR-SKSLQEVSSDKLQESSTDSRNPALALAEPYNQRGTVVSPPPTKRRTMKVV 953 Query: 284 LYHVF 270 YH+F Sbjct: 954 KYHLF 958 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 198,926 Number of Sequences: 438 Number of extensions: 4401 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24032646 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -