BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0053 (605 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ821850-1|CAH25390.1| 426|Anopheles gambiae alpha-2,6-sialyltr... 25 1.4 AB090820-1|BAC57915.1| 527|Anopheles gambiae gag-like protein p... 25 2.5 >AJ821850-1|CAH25390.1| 426|Anopheles gambiae alpha-2,6-sialyltransferase protein. Length = 426 Score = 25.4 bits (53), Expect = 1.4 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -3 Query: 267 DCSVRXGICLAGVAVLGLLCIVCRFVDELFY 175 D +R +G LGLL VCR++D + Y Sbjct: 333 DVPIRKNPPTSGFIGLGLLLPVCRYIDVVEY 363 >AB090820-1|BAC57915.1| 527|Anopheles gambiae gag-like protein protein. Length = 527 Score = 24.6 bits (51), Expect = 2.5 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +3 Query: 165 EDKSKIAHQQTYRQYKEALRQQRQQDIYXPAQNSP 269 E + ++ QQ R ++ +QQRQQ + PAQ P Sbjct: 181 EQRQQLEDQQRQRWRQQQQKQQRQQRL--PAQQWP 213 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 611,835 Number of Sequences: 2352 Number of extensions: 12552 Number of successful extensions: 31 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 58870980 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -