BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0051 (758 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbona... 26 1.1 DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren... 25 1.9 AY748841-1|AAV28189.1| 158|Anopheles gambiae cytochrome P450 pr... 25 2.5 AJ439060-4|CAD27755.1| 151|Anopheles gambiae putative sRNP prot... 24 5.9 AF395080-1|AAK97462.1| 537|Anopheles gambiae zinc finger transc... 24 5.9 >AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbonate anion exchanger protein. Length = 1102 Score = 26.2 bits (55), Expect = 1.1 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = -2 Query: 460 GVGRGQFAAHPSGGLGATDPPPLVRTLRYMIEADFCQ 350 G+G G F+ P LG+T P + T+ Y +FCQ Sbjct: 567 GIGYGFFSGQPLTILGSTGPVLVFETIVY----EFCQ 599 >DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methoprene-tolerant protein protein. Length = 1115 Score = 25.4 bits (53), Expect = 1.9 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = +1 Query: 604 ANLAVGGTVRGSCIECPFH 660 A++A+GG+ G C E PF+ Sbjct: 75 ASMAMGGSFEGDCNEKPFY 93 >AY748841-1|AAV28189.1| 158|Anopheles gambiae cytochrome P450 protein. Length = 158 Score = 25.0 bits (52), Expect = 2.5 Identities = 17/57 (29%), Positives = 28/57 (49%), Gaps = 1/57 (1%) Frame = -2 Query: 187 FVVSAFGPVSGHAVFEETASVMADGKC*RSAILFV*I*DNNFVQF-ELIIVFFLRII 20 F+V AFG + H ++ ADG R + + D +Q+ E +I+ LR+I Sbjct: 40 FLVKAFGYIVQHPEVQQRIQAEADGVLERHGRQVIELTDRAEMQYTEAVIMEALRLI 96 >AJ439060-4|CAD27755.1| 151|Anopheles gambiae putative sRNP protein. Length = 151 Score = 23.8 bits (49), Expect = 5.9 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 420 PPDGWAANCPLPTPMGGSRSP 482 PP N PLP PM G R P Sbjct: 99 PPLLMGPNGPLPPPMMGMRPP 119 >AF395080-1|AAK97462.1| 537|Anopheles gambiae zinc finger transcription factor pannier protein. Length = 537 Score = 23.8 bits (49), Expect = 5.9 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = -3 Query: 573 PGQAVLATVHAQILTQGIDREELPTLSSLVSATANH 466 PG V ++ H Q T G++ + T S S + H Sbjct: 336 PGSIVSSSAHQQHTTAGLNSSHIYTTPSSNSLSTQH 371 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 884,634 Number of Sequences: 2352 Number of extensions: 20821 Number of successful extensions: 41 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 39 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 41 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 78586767 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -