BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0048 (805 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adh... 27 0.90 Z22930-5|CAA80517.1| 275|Anopheles gambiae trypsin protein. 25 2.7 AY705405-1|AAU12514.1| 519|Anopheles gambiae nicotinic acetylch... 24 4.8 AY263175-1|AAP78790.1| 814|Anopheles gambiae TmcA-like protein ... 24 4.8 >AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adhesion protein protein. Length = 1881 Score = 26.6 bits (56), Expect = 0.90 Identities = 9/26 (34%), Positives = 18/26 (69%) Frame = -3 Query: 260 YEVGLPTPVAGALMMRIFVEVRNDNV 183 Y+ G+PTP++ + + ++V NDN+ Sbjct: 1360 YDQGIPTPLSSTVDLIVYVRDVNDNL 1385 >Z22930-5|CAA80517.1| 275|Anopheles gambiae trypsin protein. Length = 275 Score = 25.0 bits (52), Expect = 2.7 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 243 YTSCGGVNDENLCGGEK 193 Y+S GG+ D LC G K Sbjct: 203 YSSSGGITDRMLCAGYK 219 >AY705405-1|AAU12514.1| 519|Anopheles gambiae nicotinic acetylcholine receptor subunitbeta 1 protein. Length = 519 Score = 24.2 bits (50), Expect = 4.8 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = +2 Query: 329 ARFSSYNGTSVKTTVDLYILVYKSTVRYEVFL 424 A + Y G +T + YI++ + T+ Y V L Sbjct: 208 AYLNVYEGNPTETDITFYIIIRRKTLFYTVNL 239 >AY263175-1|AAP78790.1| 814|Anopheles gambiae TmcA-like protein protein. Length = 814 Score = 24.2 bits (50), Expect = 4.8 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +3 Query: 162 LRWAFKINIIISHL 203 LRW F +NI+IS L Sbjct: 156 LRWLFSVNIVISVL 169 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 779,562 Number of Sequences: 2352 Number of extensions: 16337 Number of successful extensions: 25 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 84823812 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -