BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0046 (799 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory recept... 24 1.6 DQ855491-1|ABH88178.1| 144|Tribolium castaneum chemosensory pro... 22 6.5 >AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory receptor candidate 41 protein. Length = 398 Score = 23.8 bits (49), Expect = 1.6 Identities = 14/58 (24%), Positives = 29/58 (50%), Gaps = 2/58 (3%) Frame = +1 Query: 37 GAMCLIRVF*LLNRVRVNSNLYGVGTAVVANISKRSNSIQILVN--FYAIENVKTIAL 204 G +C+ +F N+ R SN ++ ++ S SI ++VN F + ++T+ + Sbjct: 53 GCLCIWSIFNKWNQFRSYSNFSVFLFDIITIVTLTSTSILLIVNAVFVKEKRIRTLLI 110 >DQ855491-1|ABH88178.1| 144|Tribolium castaneum chemosensory protein 5 protein. Length = 144 Score = 21.8 bits (44), Expect = 6.5 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = +3 Query: 459 AHKLKSYLIAVYSNDWNLLQFTIKY 533 A K+ ++++ Y N+WN Q KY Sbjct: 96 AGKILTFVLLNYRNEWN--QLVAKY 118 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 169,366 Number of Sequences: 336 Number of extensions: 3255 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21687721 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -