BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0046 (799 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_18464| Best HMM Match : AFG1_ATPase (HMM E-Value=0.48) 29 5.8 SB_43202| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.6 >SB_18464| Best HMM Match : AFG1_ATPase (HMM E-Value=0.48) Length = 675 Score = 28.7 bits (61), Expect = 5.8 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = -3 Query: 665 SQASGGVLPYIANGSRQVLTFALGHQHCQ 579 ++ SGG ANG R++L F L HQ+ Q Sbjct: 194 TKGSGGPCGVDANGFRRILAFNLRHQYIQ 222 >SB_43202| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 28.3 bits (60), Expect = 7.6 Identities = 15/35 (42%), Positives = 18/35 (51%) Frame = +1 Query: 361 PVTSPAPTHVLMQFSSSTALTLCTYLPTLNNVSLT 465 P+T P H L +T LTL PTLN+ LT Sbjct: 33 PLTPRGPGHTLNHEKLTTPLTLTRAGPTLNHEKLT 67 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,806,013 Number of Sequences: 59808 Number of extensions: 411035 Number of successful extensions: 964 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 909 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 964 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2203769656 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -