BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0046 (799 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY553322-1|AAT36323.1| 426|Anopheles gambiae G-protein coupled ... 24 6.3 EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calc... 23 8.3 >AY553322-1|AAT36323.1| 426|Anopheles gambiae G-protein coupled receptor 4 protein. Length = 426 Score = 23.8 bits (49), Expect = 6.3 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = -3 Query: 638 YIANGSRQVLTFALGHQHCQGQKQAAPAVA 549 Y+A G ++ +L H++ Q Q+A A+A Sbjct: 2 YLAAGLLNIMDISLQHEYLQEYLQSAAAMA 31 >EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calcium channel alpha2-delta subunit 1 protein. Length = 1256 Score = 23.4 bits (48), Expect = 8.3 Identities = 7/26 (26%), Positives = 16/26 (61%) Frame = -2 Query: 606 FRSWTSTLSRSEASRSCRSNCTNNRI 529 F+ + + S+ AS +C+ NC ++ + Sbjct: 927 FKHFINITSKCTASTTCKKNCASDEL 952 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 746,480 Number of Sequences: 2352 Number of extensions: 13809 Number of successful extensions: 19 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 83992206 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -