BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0045 (812 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP... 23 3.4 L10430-1|AAA27731.1| 150|Apis mellifera transposase protein. 22 5.9 AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 22 5.9 L10433-1|AAA27732.1| 149|Apis mellifera transposase protein. 22 7.8 >Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP57-2 protein. Length = 464 Score = 23.0 bits (47), Expect = 3.4 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = +3 Query: 651 THNFYTLNVEEVFKVIREGEDKRYQ 725 + N Y +N E + K +G D +Y+ Sbjct: 271 SENLYYVNTESLMKSENQGNDVQYE 295 >L10430-1|AAA27731.1| 150|Apis mellifera transposase protein. Length = 150 Score = 22.2 bits (45), Expect = 5.9 Identities = 12/55 (21%), Positives = 27/55 (49%) Frame = +1 Query: 325 LQNLIKSGDASRNKIVDATNRFFTLIPHDFGVNNAPLLDNNEIIKTKTDMMDNLL 489 +++L K +A K + TNR + HD + L+ ++++ D++ + L Sbjct: 96 IEHLTKLNNAIEEKRFELTNRKGVVFHHDDARPHTYLVTRQKLLELGWDVLPHSL 150 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 22.2 bits (45), Expect = 5.9 Identities = 8/31 (25%), Positives = 16/31 (51%) Frame = -2 Query: 160 VDSECFRLIVTVVYFQREVSPRNLDKVIPVF 68 +D +CF+ I+ R+ + K +P+F Sbjct: 191 IDRQCFQTIMMRTGLSRQAEYTDFLKSVPIF 221 >L10433-1|AAA27732.1| 149|Apis mellifera transposase protein. Length = 149 Score = 21.8 bits (44), Expect = 7.8 Identities = 11/51 (21%), Positives = 24/51 (47%) Frame = +1 Query: 325 LQNLIKSGDASRNKIVDATNRFFTLIPHDFGVNNAPLLDNNEIIKTKTDMM 477 ++ L K +A K + TNR + HD + L+ ++++ D++ Sbjct: 95 IEQLTKLNNAVEEKRPELTNRKSVVFHHDNARPHTSLVTRQKLLELGWDVL 145 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 221,575 Number of Sequences: 438 Number of extensions: 4780 Number of successful extensions: 18 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25853301 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -