BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0044 (802 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U81040-1|AAB39356.1| 283|Tribolium castaneum TC Deformed protein. 23 3.7 U81038-1|AAB39355.1| 412|Tribolium castaneum transcription fact... 23 3.7 AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. 23 3.7 EU019710-1|ABU25222.1| 475|Tribolium castaneum dopa decarboxyla... 21 8.7 AY695258-1|AAW21975.1| 232|Tribolium castaneum muscle segment h... 21 8.7 >U81040-1|AAB39356.1| 283|Tribolium castaneum TC Deformed protein. Length = 283 Score = 22.6 bits (46), Expect = 3.7 Identities = 11/45 (24%), Positives = 23/45 (51%) Frame = +2 Query: 203 GAGNRRQAVRSEHRHLQDLGRKYGLAGANDEEAFEIDQNVEFLND 337 G+G++ +HLQ+LG + A +++++ + Q ND Sbjct: 153 GSGHQDSRTSPSGQHLQELGLRLEDANSDEQDDGDDGQGSSTNND 197 >U81038-1|AAB39355.1| 412|Tribolium castaneum transcription factor Deformed protein. Length = 412 Score = 22.6 bits (46), Expect = 3.7 Identities = 11/45 (24%), Positives = 23/45 (51%) Frame = +2 Query: 203 GAGNRRQAVRSEHRHLQDLGRKYGLAGANDEEAFEIDQNVEFLND 337 G+G++ +HLQ+LG + A +++++ + Q ND Sbjct: 153 GSGHQDSRTSPSGQHLQELGLRLEDANSDEQDDGDDGQGSSTNND 197 >AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. Length = 412 Score = 22.6 bits (46), Expect = 3.7 Identities = 11/45 (24%), Positives = 23/45 (51%) Frame = +2 Query: 203 GAGNRRQAVRSEHRHLQDLGRKYGLAGANDEEAFEIDQNVEFLND 337 G+G++ +HLQ+LG + A +++++ + Q ND Sbjct: 153 GSGHQDSRTSPSGQHLQELGLRLEDANSDEQDDGDDGQGSSTNND 197 >EU019710-1|ABU25222.1| 475|Tribolium castaneum dopa decarboxylase protein. Length = 475 Score = 21.4 bits (43), Expect = 8.7 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = +1 Query: 475 YRAWQVDLGR 504 YR WQ+ LGR Sbjct: 344 YRHWQIPLGR 353 >AY695258-1|AAW21975.1| 232|Tribolium castaneum muscle segment homeodomain protein protein. Length = 232 Score = 21.4 bits (43), Expect = 8.7 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +3 Query: 165 PEFKPKTPFGQMPVLEIDGK 224 P KP+TPF +L ++ K Sbjct: 114 PNRKPRTPFTTQQLLALEKK 133 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 146,168 Number of Sequences: 336 Number of extensions: 2582 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21791490 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -