BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0041 (803 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 24 1.4 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 23 3.3 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 23 4.4 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 24.2 bits (50), Expect = 1.4 Identities = 12/38 (31%), Positives = 18/38 (47%) Frame = +2 Query: 404 VWTQGDDGKWATTLVLLRINRAATCVKWSPMENKFLSG 517 +W +DGK L+ + V++SPME L G Sbjct: 9 LWCPDNDGKMVDLTQCLQESSTGQSVEFSPMELNALVG 46 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 23.0 bits (47), Expect = 3.3 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -3 Query: 645 EQNVIGMPINRCHSRTNGLLNMLR 574 E IG +++CH+R NM R Sbjct: 700 EPQPIGKALSKCHNRNVTTCNMFR 723 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 22.6 bits (46), Expect = 4.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 530 NLAPDPTETCSPWETISRKSLLG 462 N +P P E C+ TI+ +S G Sbjct: 742 NASPSPAEQCASTTTITARSPQG 764 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 230,333 Number of Sequences: 438 Number of extensions: 5146 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25489170 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -