BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0040 (758 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcript... 29 0.21 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 27 0.48 AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 27 0.83 AY146717-1|AAO12077.1| 188|Anopheles gambiae odorant-binding pr... 26 1.1 DQ103706-1|AAZ43087.1| 344|Anopheles gambiae pk-1 receptor prot... 26 1.5 AY183376-1|AAO24766.1| 128|Anopheles gambiae cytochrome b5 prot... 26 1.5 EF427621-5|ABO09853.1| 62|Anopheles gambiae tal-like protein A... 25 3.3 U03849-1|AAA53488.1| 388|Anopheles gambiae putative nucleic aci... 24 4.4 AY330172-1|AAQ16278.1| 170|Anopheles gambiae odorant-binding pr... 24 4.4 AB090814-2|BAC57904.1| 1049|Anopheles gambiae reverse transcript... 23 7.7 >AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcriptase protein. Length = 973 Score = 28.7 bits (61), Expect = 0.21 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = -2 Query: 736 KQHTTLNSYVNQFTAMHSVTGSYIHKF 656 ++H +N Y+ QF + H SY+HK+ Sbjct: 874 RKHGEVNFYMTQFLSDHGCFRSYLHKY 900 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 27.5 bits (58), Expect = 0.48 Identities = 15/40 (37%), Positives = 19/40 (47%) Frame = +2 Query: 497 SHPHSRSYKCITPILIASYYEGLSSFVSDLSLGLYNNKYI 616 SHP RS P + S Y+G +S S+G N YI Sbjct: 424 SHPRRRSNSLPIPQIEISLYQGPTSSRDSPSIGSANKDYI 463 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 26.6 bits (56), Expect = 0.83 Identities = 13/33 (39%), Positives = 18/33 (54%), Gaps = 4/33 (12%) Frame = -2 Query: 328 SSHQSLSFLWHH----RSQMHRCFLRHHHFSRR 242 S H+++S WHH R Q H C + F+RR Sbjct: 903 SCHKTVSNRWHHANIHRPQSHECPVCGQKFTRR 935 >AY146717-1|AAO12077.1| 188|Anopheles gambiae odorant-binding protein AgamOBP14 protein. Length = 188 Score = 26.2 bits (55), Expect = 1.1 Identities = 14/45 (31%), Positives = 21/45 (46%) Frame = -3 Query: 297 ITVLRCIVAFFGITISAGESSGASSVPFSLPLLSAASTFLAGDFL 163 I L ++ T SA ++S +P + A STF+ DFL Sbjct: 6 IATLTVLLVLLAGTASAKKASTIFGMPLQQDPVPATSTFIVSDFL 50 >DQ103706-1|AAZ43087.1| 344|Anopheles gambiae pk-1 receptor protein. Length = 344 Score = 25.8 bits (54), Expect = 1.5 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = -3 Query: 348 IKSHRFPLHTSLFLFCGITVLRCIVAFFGITI 253 I H F L T LF F +T++ + A G+ + Sbjct: 202 IIQHSFELSTFLFFFAPMTMITILYALIGLKL 233 >AY183376-1|AAO24766.1| 128|Anopheles gambiae cytochrome b5 protein. Length = 128 Score = 25.8 bits (54), Expect = 1.5 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +2 Query: 89 ADAAVDKKEVAPEEVTSTEPKESPVKKSPAKKVEAAESN 205 +DA K+ E+ E K+ PVKK P K++ + N Sbjct: 65 SDAREMMKKFKVGELIEAERKQIPVKKEPDWKMDQQDDN 103 >EF427621-5|ABO09853.1| 62|Anopheles gambiae tal-like protein AA protein. Length = 62 Score = 24.6 bits (51), Expect = 3.3 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = -2 Query: 331 SSSHQSLSFLWHHRSQMHRCFLRHHH 254 +SS Q F HH+ Q + + HHH Sbjct: 18 ASSSQRSPFHHHHQQQQNHQRMPHHH 43 >U03849-1|AAA53488.1| 388|Anopheles gambiae putative nucleic acid binding protein protein. Length = 388 Score = 24.2 bits (50), Expect = 4.4 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = +2 Query: 83 TMADAAVDKKEVAPEEVTSTEPKESPVKKSP 175 T AV P E+ T+P SP++ +P Sbjct: 171 TNTTIAVQPAPTQPHELVGTDPLSSPLQAAP 201 >AY330172-1|AAQ16278.1| 170|Anopheles gambiae odorant-binding protein AgamOBP52 protein. Length = 170 Score = 24.2 bits (50), Expect = 4.4 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +2 Query: 446 IIYAWFTAMHQCPLEFNSHP 505 +++ FT +CPL F+ HP Sbjct: 1 MLFKLFTIPFRCPLFFSKHP 20 >AB090814-2|BAC57904.1| 1049|Anopheles gambiae reverse transcriptase protein. Length = 1049 Score = 23.4 bits (48), Expect = 7.7 Identities = 8/27 (29%), Positives = 16/27 (59%) Frame = -2 Query: 736 KQHTTLNSYVNQFTAMHSVTGSYIHKF 656 ++H ++ +V Q + H SY+H+F Sbjct: 937 RKHGDVDYFVTQVLSGHGCFRSYLHRF 963 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 698,477 Number of Sequences: 2352 Number of extensions: 12705 Number of successful extensions: 33 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 32 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 78586767 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -