BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0038 (791 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC23E2.02 |lsd2|swm2, saf140|histone demethylase SWIRM2 |Schiz... 27 2.3 SPAC23E2.03c |ste7||meiotic suppressor protein Ste7|Schizosaccha... 27 4.1 SPCC1739.11c |cdc11||SIN component scaffold protein Cdc11|Schizo... 26 7.1 >SPAC23E2.02 |lsd2|swm2, saf140|histone demethylase SWIRM2 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1273 Score = 27.5 bits (58), Expect = 2.3 Identities = 23/65 (35%), Positives = 31/65 (47%), Gaps = 4/65 (6%) Frame = -2 Query: 256 PLTRGSHIRCADFFDAPQSRWNE----R*TGAVGFYPYSH*NYTSKNLSA*HFQLSPNTD 89 PL R S I CA +F +SR+NE R T V FY + TS+N H+ T+ Sbjct: 2 PLGRSSWICCAKYFVNTKSRFNEILPPRFTLIVSFYSMN----TSENDPDGHYDFPEMTE 57 Query: 88 TTAQR 74 + R Sbjct: 58 HHSDR 62 >SPAC23E2.03c |ste7||meiotic suppressor protein Ste7|Schizosaccharomyces pombe|chr 1|||Manual Length = 569 Score = 26.6 bits (56), Expect = 4.1 Identities = 13/45 (28%), Positives = 22/45 (48%) Frame = -2 Query: 256 PLTRGSHIRCADFFDAPQSRWNER*TGAVGFYPYSH*NYTSKNLS 122 P T S + ++ FD+ + +N TG Y + +YT+ N S Sbjct: 314 PSTPSSAVTLSNGFDSQSNAYNNSGTGPPMLYKFPQRSYTAPNTS 358 >SPCC1739.11c |cdc11||SIN component scaffold protein Cdc11|Schizosaccharomyces pombe|chr 3|||Manual Length = 1045 Score = 25.8 bits (54), Expect = 7.1 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 138 QAKTFPLNISN*VQIQTPPHSVRDS 64 Q +FPL N Q + P HS+RD+ Sbjct: 501 QPHSFPLRKQNVAQSEFPKHSLRDN 525 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,116,864 Number of Sequences: 5004 Number of extensions: 60585 Number of successful extensions: 140 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 133 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 140 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 385381248 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -