BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0036 (668 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_31443| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_48915| Best HMM Match : Pep_M12B_propep (HMM E-Value=0.0031) 31 0.85 SB_36609| Best HMM Match : Ion_trans_2 (HMM E-Value=1.7e-13) 31 0.85 SB_21536| Best HMM Match : RVT_1 (HMM E-Value=0.0043) 30 2.0 SB_18180| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_34750| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_21593| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_54100| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_4001| Best HMM Match : Exo_endo_phos (HMM E-Value=0.0056) 29 3.4 SB_29906| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_56230| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_46085| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_39435| Best HMM Match : 7tm_1 (HMM E-Value=4.60004e-41) 29 4.5 SB_43124| Best HMM Match : DUF1162 (HMM E-Value=4.3e-17) 28 6.0 SB_344| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_58994| Best HMM Match : EGF_CA (HMM E-Value=2.3e-29) 28 7.9 SB_5862| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 >SB_31443| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 779 Score = 43.6 bits (98), Expect = 1e-04 Identities = 34/143 (23%), Positives = 67/143 (46%), Gaps = 7/143 (4%) Frame = +2 Query: 254 MFLKSNVDLGGLAQIIISQNYIGSVVK------QCLXXXXXXXXXXXXXXXXVFGVTTVV 415 +FLK+ V+L LA +II+Q+ IGS++K Q ++G+ +V+ Sbjct: 474 LFLKNTVNLSELADLIIAQDKIGSIIKVVDDEEQAEDSNNPSAEEEGEYEEEIYGLVSVL 533 Query: 416 NITKRKNEPSVAQIRELLTKLSQENADPRTKN*LNIFWXXXXXXXXXXXXKE-Y*TFLQR 592 ++ + K + V QI++LL + + + P L+ F E + + Sbjct: 534 DLAQHKEKQCVKQIKDLLLEKCKACSKPEA---LSSFQNILSNKSVGLLISERFINIPPQ 590 Query: 593 LAYPLFASLQTELEKAHRKNMLY 661 +A PL+ +L EL++ ++K + Sbjct: 591 IAPPLYRTLGNELKEQNKKQSTF 613 >SB_48915| Best HMM Match : Pep_M12B_propep (HMM E-Value=0.0031) Length = 511 Score = 31.1 bits (67), Expect = 0.85 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = +3 Query: 114 EQDSGSEKDSDFDSDGNYVGEKXLQADFEGRNPEDSDFHG 233 + DSGS+ D D D DG+ G+ D +G D D G Sbjct: 199 DSDSGSDSDGDGDGDGDGDGDGDGDGDGDGDGDGDGDGDG 238 Score = 29.9 bits (64), Expect = 2.0 Identities = 17/51 (33%), Positives = 23/51 (45%) Frame = +3 Query: 81 RKLTQTAKATKEQDSGSEKDSDFDSDGNYVGEKXLQADFEGRNPEDSDFHG 233 ++ TQ + DS S DSD D DG+ G+ D +G D D G Sbjct: 186 KRATQCDDVDGDGDSDSGSDSDGDGDGDGDGDGDGDGDGDGDGDGDGDGDG 236 >SB_36609| Best HMM Match : Ion_trans_2 (HMM E-Value=1.7e-13) Length = 661 Score = 31.1 bits (67), Expect = 0.85 Identities = 14/40 (35%), Positives = 19/40 (47%) Frame = +3 Query: 114 EQDSGSEKDSDFDSDGNYVGEKXLQADFEGRNPEDSDFHG 233 + D + D D D DGN GE D +G + +D D G Sbjct: 612 DDDDDGDDDGDEDDDGNDDGEDEDDGDDDGEDEDDGDDDG 651 Score = 29.1 bits (62), Expect = 3.4 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = +3 Query: 114 EQDSGSEKDSDFDSDGNYVGEKXLQADFEGRNPEDSDFHG 233 + D G + D D D DG+ G++ + +G + +D D G Sbjct: 602 DDDDGDDGDGDDDDDGDDDGDEDDDGNDDGEDEDDGDDDG 641 >SB_21536| Best HMM Match : RVT_1 (HMM E-Value=0.0043) Length = 831 Score = 29.9 bits (64), Expect = 2.0 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +3 Query: 90 TQTAKATKEQDSGSEKDSDFDSDGNY 167 T T+K+ K +S E+DSD D D +Y Sbjct: 679 TMTSKSDKTSESNKEEDSDDDDDDDY 704 Score = 28.7 bits (61), Expect = 4.5 Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = +3 Query: 78 TRKLTQTAKATKEQDSGSEKDSDFDSDGNYVGE-KXLQAD 194 T K +T+++ KE+DS + D D+ D + E K L D Sbjct: 681 TSKSDKTSESNKEEDSDDDDDDDYGDDSDKSNEAKVLDRD 720 >SB_18180| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 358 Score = 29.9 bits (64), Expect = 2.0 Identities = 17/55 (30%), Positives = 27/55 (49%) Frame = +3 Query: 69 IKRTRKLTQTAKATKEQDSGSEKDSDFDSDGNYVGEKXLQADFEGRNPEDSDFHG 233 IKR +K+ Q + D+ + D+D D+DG + G+ D +G D D G Sbjct: 105 IKR-KKVKQQRIKKYDDDADDDADADADADGYFDGDGDGDGDGDGDGDGDGDGDG 158 >SB_34750| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +3 Query: 114 EQDSGSEKDSDFDSDGNYVGEKXLQADFEGRNPEDSD 224 + DS S+ DSD DSD + + +D + + DSD Sbjct: 12 DNDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 48 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +3 Query: 114 EQDSGSEKDSDFDSDGNYVGEKXLQADFEGRNPEDSD 224 + DS S+ DSD DSD + + +D + + DSD Sbjct: 14 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 50 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +3 Query: 114 EQDSGSEKDSDFDSDGNYVGEKXLQADFEGRNPEDSD 224 + DS S+ DSD DSD + + +D + + DSD Sbjct: 16 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 52 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +3 Query: 114 EQDSGSEKDSDFDSDGNYVGEKXLQADFEGRNPEDSD 224 + DS S+ DSD DSD + + +D + + DSD Sbjct: 18 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 54 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +3 Query: 114 EQDSGSEKDSDFDSDGNYVGEKXLQADFEGRNPEDSD 224 + DS S+ DSD DSD + + +D + + DSD Sbjct: 20 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 56 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +3 Query: 114 EQDSGSEKDSDFDSDGNYVGEKXLQADFEGRNPEDSD 224 + DS S+ DSD DSD + + +D + + DSD Sbjct: 22 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 58 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +3 Query: 114 EQDSGSEKDSDFDSDGNYVGEKXLQADFEGRNPEDSD 224 + DS S+ DSD DSD + + +D + + DSD Sbjct: 24 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 60 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +3 Query: 114 EQDSGSEKDSDFDSDGNYVGEKXLQADFEGRNPEDSD 224 + DS S+ DSD DSD + + +D + + DSD Sbjct: 26 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 62 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +3 Query: 114 EQDSGSEKDSDFDSDGNYVGEKXLQADFEGRNPEDSD 224 + DS S+ DSD DSD + + +D + + DSD Sbjct: 28 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 64 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +3 Query: 114 EQDSGSEKDSDFDSDGNYVGEKXLQADFEGRNPEDSD 224 + DS S+ DSD DSD + + +D + + DSD Sbjct: 30 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 66 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +3 Query: 114 EQDSGSEKDSDFDSDGNYVGEKXLQADFEGRNPEDSD 224 + DS S+ DSD DSD + + +D + + DSD Sbjct: 32 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 68 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +3 Query: 114 EQDSGSEKDSDFDSDGNYVGEKXLQADFEGRNPEDSD 224 + DS S+ DSD DSD + + +D + + DSD Sbjct: 34 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 70 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +3 Query: 114 EQDSGSEKDSDFDSDGNYVGEKXLQADFEGRNPEDSD 224 + DS S+ DSD DSD + + +D + + DSD Sbjct: 36 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 72 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +3 Query: 114 EQDSGSEKDSDFDSDGNYVGEKXLQADFEGRNPEDSD 224 + DS S+ DSD DSD + + +D + + DSD Sbjct: 38 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 74 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +3 Query: 114 EQDSGSEKDSDFDSDGNYVGEKXLQADFEGRNPEDSD 224 + DS S+ DSD DSD + + +D + + DSD Sbjct: 40 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 76 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +3 Query: 114 EQDSGSEKDSDFDSDGNYVGEKXLQADFEGRNPEDSD 224 + DS S+ DSD DSD + + +D + + DSD Sbjct: 42 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 78 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +3 Query: 114 EQDSGSEKDSDFDSDGNYVGEKXLQADFEGRNPEDSD 224 + DS S+ DSD DSD + + +D + + DSD Sbjct: 44 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 80 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +3 Query: 114 EQDSGSEKDSDFDSDGNYVGEKXLQADFEGRNPEDSD 224 + DS S+ DSD DSD + + +D + + DSD Sbjct: 46 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 82 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +3 Query: 114 EQDSGSEKDSDFDSDGNYVGEKXLQADFEGRNPEDSD 224 + DS S+ DSD DSD + + +D + + DSD Sbjct: 48 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 84 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +3 Query: 114 EQDSGSEKDSDFDSDGNYVGEKXLQADFEGRNPEDSD 224 + DS S+ DSD DSD + + +D + + DSD Sbjct: 50 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 86 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +3 Query: 114 EQDSGSEKDSDFDSDGNYVGEKXLQADFEGRNPEDSD 224 + DS S+ DSD DSD + + +D + + DSD Sbjct: 52 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 88 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +3 Query: 114 EQDSGSEKDSDFDSDGNYVGEKXLQADFEGRNPEDSD 224 + DS S+ DSD DSD + + +D + + DSD Sbjct: 54 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 90 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +3 Query: 114 EQDSGSEKDSDFDSDGNYVGEKXLQADFEGRNPEDSD 224 + DS S+ DSD DSD + + +D + + DSD Sbjct: 56 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 92 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +3 Query: 114 EQDSGSEKDSDFDSDGNYVGEKXLQADFEGRNPEDSD 224 + DS S+ DSD DSD + + +D + + DSD Sbjct: 58 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 94 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +3 Query: 114 EQDSGSEKDSDFDSDGNYVGEKXLQADFEGRNPEDSD 224 + DS S+ DSD DSD + + +D + + DSD Sbjct: 60 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 96 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +3 Query: 114 EQDSGSEKDSDFDSDGNYVGEKXLQADFEGRNPEDSD 224 + DS S+ DSD DSD + + +D + + DSD Sbjct: 62 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 98 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +3 Query: 114 EQDSGSEKDSDFDSDGNYVGEKXLQADFEGRNPEDSD 224 + DS S+ DSD DSD + + +D + + DSD Sbjct: 64 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 100 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +3 Query: 114 EQDSGSEKDSDFDSDGNYVGEKXLQADFEGRNPEDSD 224 + DS S+ DSD DSD + + +D + + DSD Sbjct: 66 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 102 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +3 Query: 114 EQDSGSEKDSDFDSDGNYVGEKXLQADFEGRNPEDSD 224 + DS S+ DSD DSD + + +D + + DSD Sbjct: 68 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 104 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +3 Query: 114 EQDSGSEKDSDFDSDGNYVGEKXLQADFEGRNPEDSD 224 + DS S+ DSD DSD + + +D + + DSD Sbjct: 70 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 106 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +3 Query: 114 EQDSGSEKDSDFDSDGNYVGEKXLQADFEGRNPEDSD 224 + DS S+ DSD DSD + + +D + + DSD Sbjct: 72 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 108 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +3 Query: 114 EQDSGSEKDSDFDSDGNYVGEKXLQADFEGRNPEDSD 224 + DS S+ DSD DSD + + +D + + DSD Sbjct: 74 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 110 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +3 Query: 114 EQDSGSEKDSDFDSDGNYVGEKXLQADFEGRNPEDSD 224 + DS S+ DSD DSD + + +D + + DSD Sbjct: 76 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 112 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +3 Query: 114 EQDSGSEKDSDFDSDGNYVGEKXLQADFEGRNPEDSD 224 + DS S+ DSD DSD + + +D + + DSD Sbjct: 78 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 114 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +3 Query: 114 EQDSGSEKDSDFDSDGNYVGEKXLQADFEGRNPEDSD 224 + DS S+ DSD DSD + + +D + + DSD Sbjct: 80 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 116 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +3 Query: 114 EQDSGSEKDSDFDSDGNYVGEKXLQADFEGRNPEDSD 224 + DS S+ DSD DSD + + +D + + DSD Sbjct: 82 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 118 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +3 Query: 114 EQDSGSEKDSDFDSDGNYVGEKXLQADFEGRNPEDSD 224 + DS S+ DSD DSD + + +D + + DSD Sbjct: 84 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 120 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +3 Query: 114 EQDSGSEKDSDFDSDGNYVGEKXLQADFEGRNPEDSD 224 + DS S+ DSD DSD + + +D + + DSD Sbjct: 86 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 122 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +3 Query: 114 EQDSGSEKDSDFDSDGNYVGEKXLQADFEGRNPEDSD 224 + DS S+ DSD DSD + + +D + + DSD Sbjct: 88 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 124 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +3 Query: 114 EQDSGSEKDSDFDSDGNYVGEKXLQADFEGRNPEDSD 224 + DS S+ DSD DSD + + +D + + DSD Sbjct: 90 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 126 Score = 28.3 bits (60), Expect = 6.0 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +3 Query: 114 EQDSGSEKDSDFDSDGNYVGEKXLQADFEGRNPEDSD 224 + D+ S+ DSD DSD + + +D + + DSD Sbjct: 10 DNDNDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 46 Score = 27.9 bits (59), Expect = 7.9 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +3 Query: 114 EQDSGSEKDSDFDSDGNYVGEKXLQADFEGRNPEDSD 224 + DS S+ DSD DSD + + +D + + DS+ Sbjct: 92 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSE 128 >SB_21593| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 29.5 bits (63), Expect = 2.6 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = +3 Query: 114 EQDSGSEKDSDFDSDGNYVGEKXLQADFEGRNPEDSD 224 + D G E+D+D D D +Y E+ + D +G ED+D Sbjct: 83 DDDDGYEEDNDCDDD-DYDYEEDIDGDDDGDYEEDND 118 >SB_54100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3287 Score = 29.5 bits (63), Expect = 2.6 Identities = 12/51 (23%), Positives = 26/51 (50%) Frame = +3 Query: 72 KRTRKLTQTAKATKEQDSGSEKDSDFDSDGNYVGEKXLQADFEGRNPEDSD 224 ++ +K + K K+ D+ ++ D+D D+D + + D + N D+D Sbjct: 3123 EKQKKKKKKKKEEKKNDNNNDNDNDNDNDNDNDNDNDNDNDIDNDNDNDND 3173 Score = 29.1 bits (62), Expect = 3.4 Identities = 12/51 (23%), Positives = 25/51 (49%) Frame = +3 Query: 72 KRTRKLTQTAKATKEQDSGSEKDSDFDSDGNYVGEKXLQADFEGRNPEDSD 224 K+ +K + K D+ ++ D+D D+D + + + D + N D+D Sbjct: 3127 KKKKKKKEEKKNDNNNDNDNDNDNDNDNDNDNDNDNDIDNDNDNDNDNDND 3177 >SB_4001| Best HMM Match : Exo_endo_phos (HMM E-Value=0.0056) Length = 508 Score = 29.1 bits (62), Expect = 3.4 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +3 Query: 114 EQDSGSEKDSDFDSDGNYVGEKXLQADFEGRNPEDSDFHG 233 + DS ++ DSD D DG+Y + D +G +D + G Sbjct: 417 DSDSDNDDDSDGDGDGDYDSDGDGDYDSDGDGDDDDNGDG 456 >SB_29906| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2463 Score = 29.1 bits (62), Expect = 3.4 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +3 Query: 84 KLTQTAKATKEQDSGSEKDSDFDSDGNYVGEKXLQADFE 200 +L Q K+ + G+ D DF+ + Y E+ LQA E Sbjct: 2038 RLLQAEKSERFAGEGASDDEDFEEEEEYYRERYLQASRE 2076 >SB_56230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 996 Score = 28.7 bits (61), Expect = 4.5 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = +3 Query: 111 KEQDSGSEKDSDFDSDGNYVGEKXLQADFEGRNPEDSD 224 +E+D G E SD DSD + + +D N +D D Sbjct: 924 RERDEGGEGYSDSDSDSDSDSDSDSDSDSHHNNDDDDD 961 >SB_46085| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 28.7 bits (61), Expect = 4.5 Identities = 16/50 (32%), Positives = 23/50 (46%), Gaps = 1/50 (2%) Frame = +3 Query: 78 TRKLTQTAKATKEQDSGS-EKDSDFDSDGNYVGEKXLQADFEGRNPEDSD 224 T +T T + D G + D D D DG+ G+ D +G + DSD Sbjct: 12 TMTMTMTMTIDDDDDDGDGDGDGDGDGDGDGDGDGDGDGDGDGDSDSDSD 61 >SB_39435| Best HMM Match : 7tm_1 (HMM E-Value=4.60004e-41) Length = 352 Score = 28.7 bits (61), Expect = 4.5 Identities = 19/49 (38%), Positives = 26/49 (53%) Frame = -2 Query: 235 IPWKSLSSGLRPSKSACSXFSPT*LPSESKSESFSLPESCSFVAFAVCV 89 I + S+ GL +KS CS PT ESK + L S + +AF +CV Sbjct: 198 ICYLSILKGLFITKSICSETVPTDTNRESKKKLAKLLASVT-IAFYICV 245 >SB_43124| Best HMM Match : DUF1162 (HMM E-Value=4.3e-17) Length = 849 Score = 28.3 bits (60), Expect = 6.0 Identities = 15/50 (30%), Positives = 20/50 (40%) Frame = +3 Query: 84 KLTQTAKATKEQDSGSEKDSDFDSDGNYVGEKXLQADFEGRNPEDSDFHG 233 K T + D + D D D DG+ G+ D +G D D HG Sbjct: 445 KATSDGYGDGDGDGDGDGDGDGDGDGDGDGDGDGDGDGDGDGDGDGDGHG 494 >SB_344| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 510 Score = 28.3 bits (60), Expect = 6.0 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +3 Query: 102 KATKEQDSGSEKDSDFDSDGNYVGEKXLQADFEGRNPED 218 KA+K + EKD++ D+D K A EG++PED Sbjct: 456 KASKRESRSVEKDNEGDADA-----KDEDAKLEGKSPED 489 >SB_58994| Best HMM Match : EGF_CA (HMM E-Value=2.3e-29) Length = 309 Score = 27.9 bits (59), Expect = 7.9 Identities = 14/41 (34%), Positives = 20/41 (48%) Frame = +3 Query: 102 KATKEQDSGSEKDSDFDSDGNYVGEKXLQADFEGRNPEDSD 224 K + D +E D+D DSD + + +D E N DSD Sbjct: 12 KNDNDNDIVNENDNDNDSDSDNENDDDNDSDNENDNDSDSD 52 Score = 27.9 bits (59), Expect = 7.9 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +3 Query: 114 EQDSGSEKDSDFDSDGNYVGEKXLQADFEGRNPEDSD 224 + DS S+ ++D D+D + + +D E N DSD Sbjct: 26 DNDSDSDNENDDDNDSDNENDNDSDSDNENDNVNDSD 62 >SB_5862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2353 Score = 27.9 bits (59), Expect = 7.9 Identities = 17/43 (39%), Positives = 21/43 (48%) Frame = -2 Query: 163 LPSESKSESFSLPESCSFVAFAVCVNFLVLFIRHFSKINKRGG 35 LP+ S ES S F+A V V LVLF+ + KR G Sbjct: 1970 LPTASARESVPFYRSIWFIAVIVLVAILVLFLLLALCLKKRSG 2012 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,681,353 Number of Sequences: 59808 Number of extensions: 283748 Number of successful extensions: 1677 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 939 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1540 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1729817375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -