BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0032 (467 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY695258-1|AAW21975.1| 232|Tribolium castaneum muscle segment h... 21 4.3 AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. 21 5.7 AJ845188-1|CAH60165.1| 517|Tribolium castaneum putative esteras... 21 7.5 >AY695258-1|AAW21975.1| 232|Tribolium castaneum muscle segment homeodomain protein protein. Length = 232 Score = 21.4 bits (43), Expect = 4.3 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = -3 Query: 258 SSPRVSQTV*PPPFRFDSRKASDHRSP 178 SSP+ S PP R RK +R P Sbjct: 92 SSPQTSAPTGPPIVRCALRKHKPNRKP 118 >AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. Length = 256 Score = 21.0 bits (42), Expect = 5.7 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = +1 Query: 388 HPRHDRHWVSS 420 H RH+RH+ SS Sbjct: 89 HDRHERHFESS 99 >AJ845188-1|CAH60165.1| 517|Tribolium castaneum putative esterase protein. Length = 517 Score = 20.6 bits (41), Expect = 7.5 Identities = 10/31 (32%), Positives = 14/31 (45%) Frame = +2 Query: 350 ANIWALKQVGCTHILATTATGSLVEEYRPGD 442 ANIW LK+V + T + + GD Sbjct: 267 ANIWGLKKVYAPVVDGEFLTDEPIATIKSGD 297 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 105,660 Number of Sequences: 336 Number of extensions: 2093 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10826639 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -