BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0032 (467 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_1875| Best HMM Match : No HMM Matches (HMM E-Value=.) 89 2e-18 SB_1950| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 >SB_1875| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 360 Score = 88.6 bits (210), Expect = 2e-18 Identities = 36/56 (64%), Positives = 44/56 (78%) Frame = +2 Query: 299 ARHGRKHQLQPSDVNYRANIWALKQVGCTHILATTATGSLVEEYRPGDLVILDDFI 466 A HGRKH + P+D+NYRAN+WALK+ GCTHI+ TTA GSL E YRPG++V D I Sbjct: 218 AGHGRKHTVMPTDINYRANVWALKEEGCTHIVVTTACGSLTEAYRPGEIVFPDQII 273 >SB_1950| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 420 Score = 28.7 bits (61), Expect = 2.5 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +2 Query: 350 ANIWALKQVGCTHILATTATGSL 418 A +W +K+ CTH+L T T S+ Sbjct: 186 ARVWDIKEARCTHVLDTPHTDSV 208 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,846,246 Number of Sequences: 59808 Number of extensions: 255625 Number of successful extensions: 491 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 464 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 491 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 969807871 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -