BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0030 (567 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_1197 - 11372764-11373174 30 1.1 03_05_0637 - 26312348-26313004,26313507-26313575,26313799-26314071 29 2.0 10_03_0007 - 6956215-6956223,6957082-6957300,6957874-6957978,695... 28 4.5 >07_01_1197 - 11372764-11373174 Length = 136 Score = 30.3 bits (65), Expect = 1.1 Identities = 14/32 (43%), Positives = 20/32 (62%) Frame = -2 Query: 347 SKHVLDSTSNCQCCRRETKVSKIVCDSLYFSL 252 +K VL T++ QCC R + K++C L FSL Sbjct: 105 AKDVL-RTNDLQCCSRPSSPGKLICKKLGFSL 135 >03_05_0637 - 26312348-26313004,26313507-26313575,26313799-26314071 Length = 332 Score = 29.5 bits (63), Expect = 2.0 Identities = 16/48 (33%), Positives = 23/48 (47%), Gaps = 5/48 (10%) Frame = +2 Query: 212 MPWCLRVRRTRRAKGKSRDYHRQSWKL--WFLSGNIDSSK---LNRVH 340 M WC R+R K Y R W+L +FL + D+ + L R+H Sbjct: 22 MRWCWRMRMRHHGTWKKWIYQRLGWELLPFFLCNHCDTDRQALLRRIH 69 >10_03_0007 - 6956215-6956223,6957082-6957300,6957874-6957978, 6958062-6958175,6958342-6958467,6958583-6958697, 6958791-6958867,6958956-6959179,6959848-6959953, 6960065-6960163,6960282-6960467,6960611-6960613 Length = 460 Score = 28.3 bits (60), Expect = 4.5 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = +3 Query: 39 SQFTLFKLSEPN*NKENVANTVYSKYFHSLRYK 137 + ++LFKL+ N + + V YFH L Y+ Sbjct: 116 ANYSLFKLARTNNRGDGLLTAVNKNYFHVLNYR 148 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,638,972 Number of Sequences: 37544 Number of extensions: 190931 Number of successful extensions: 312 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 311 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 312 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1305140760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -