BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0030 (567 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578795-1|AAT07300.1| 441|Anopheles gambiae Gbb-60A2 protein. 26 0.75 AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adh... 23 9.2 >AY578795-1|AAT07300.1| 441|Anopheles gambiae Gbb-60A2 protein. Length = 441 Score = 26.2 bits (55), Expect = 0.75 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +2 Query: 269 YHRQSWKLWFLSGNIDSSKLNRVHVYYSQR*FIGR 373 +HR +LWF + ID+ + N +Y S R + R Sbjct: 137 HHRGGHRLWFDTAEIDAERDNNQLLYASLRMYKNR 171 >AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adhesion protein protein. Length = 1881 Score = 22.6 bits (46), Expect = 9.2 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +1 Query: 115 TFIV*DINDQVPCLNVTKYLC 177 T IV D+ND++P Y C Sbjct: 385 TVIVTDVNDEIPRFRSDGYEC 405 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 494,695 Number of Sequences: 2352 Number of extensions: 8769 Number of successful extensions: 18 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 53404389 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -