BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0028 (801 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g42980.1 68415.m05332 aspartyl protease family protein contai... 29 2.7 At5g55870.1 68418.m06964 hypothetical protein contains Pfam prof... 28 8.3 >At2g42980.1 68415.m05332 aspartyl protease family protein contains pfam profile: PF00026 eukaryotic aspartyl protease Length = 527 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/29 (37%), Positives = 20/29 (68%) Frame = +1 Query: 208 NIPVLDPNFSMAGVESNHLQHDTYGMSVV 294 + PVLDP F+++G+E N++ G++ V Sbjct: 434 DFPVLDPCFNVSGIEENNIHLPELGIAFV 462 >At5g55870.1 68418.m06964 hypothetical protein contains Pfam profile PF03478: Protein of unknown function (DUF295) Length = 224 Score = 27.9 bits (59), Expect = 8.3 Identities = 18/67 (26%), Positives = 34/67 (50%), Gaps = 9/67 (13%) Frame = +1 Query: 184 VNAVLNNFNIPVLDPNFSMAGVESNHLQ------HDTYGMSVVYVLIDLD-LNARRGY-- 336 +N L N N + F + SNH++ YG+SV+Y++ ++ LN ++ + Sbjct: 144 INTFLTNTNQHAQNHLFMDSKTLSNHIKIKIHQFQSKYGLSVIYIINSINLLNQKKKFHE 203 Query: 337 VSFDLSF 357 + FD+ F Sbjct: 204 IDFDMDF 210 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,589,746 Number of Sequences: 28952 Number of extensions: 295698 Number of successful extensions: 548 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 543 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 548 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1814318400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -