BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0024 (718 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 23 2.2 AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-act... 23 2.2 D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. 22 5.0 AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase pro... 22 5.0 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 23.4 bits (48), Expect = 2.2 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = +2 Query: 191 HKLESFTVVYSSYIATTKCLLNRSGLDNNF 280 H S V+S + T CLL R +NNF Sbjct: 610 HASASEESVHSMELRTLPCLLPRPKSENNF 639 >AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-activated ion channel protein. Length = 632 Score = 23.4 bits (48), Expect = 2.2 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = +2 Query: 191 HKLESFTVVYSSYIATTKCLLNRSGLDNNF 280 H S V+S + T CLL R +NNF Sbjct: 578 HASASEESVHSMELRTLPCLLPRPKSENNF 607 >D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 22.2 bits (45), Expect = 5.0 Identities = 8/18 (44%), Positives = 14/18 (77%) Frame = +3 Query: 306 ADEKDKKSFYEMARECAA 359 A++KDK SF+ M ++ A+ Sbjct: 451 AEKKDKNSFFNMFKKFAS 468 >AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 22.2 bits (45), Expect = 5.0 Identities = 8/18 (44%), Positives = 14/18 (77%) Frame = +3 Query: 306 ADEKDKKSFYEMARECAA 359 A++KDK SF+ M ++ A+ Sbjct: 451 AEKKDKNSFFNMFKKFAS 468 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 186,306 Number of Sequences: 438 Number of extensions: 3568 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22170330 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -