BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0022 (648 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. 27 0.51 U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. 27 0.51 AY330179-1|AAQ16285.1| 171|Anopheles gambiae odorant-binding pr... 27 0.68 AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl s... 27 0.68 AY334007-1|AAR01132.1| 202|Anopheles gambiae odorant receptor 1... 25 2.7 AY334006-1|AAR01131.1| 202|Anopheles gambiae odorant receptor 1... 25 2.7 AY334005-1|AAR01130.1| 202|Anopheles gambiae odorant receptor 1... 25 2.7 AF364130-1|AAL35506.1| 417|Anopheles gambiae putative odorant r... 25 2.7 AJ515150-1|CAD56157.2| 737|Anopheles gambiae acetylcholinestera... 24 3.6 AJ515149-1|CAD56156.1| 737|Anopheles gambiae acetylcholinestera... 24 3.6 AJ488492-1|CAD32684.2| 623|Anopheles gambiae acetylcholinestera... 24 3.6 CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 23 8.3 AY705401-1|AAU12510.1| 490|Anopheles gambiae nicotinic acetylch... 23 8.3 AY705400-1|AAU12509.1| 490|Anopheles gambiae nicotinic acetylch... 23 8.3 AJ276487-1|CAB90819.1| 375|Anopheles gambiae serine protease pr... 23 8.3 >U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 27.1 bits (57), Expect = 0.51 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = +1 Query: 412 PYSQHASHPSDHSLIYHDA 468 PY QH HP+ H + H A Sbjct: 173 PYPQHVLHPAHHPALLHPA 191 >U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 27.1 bits (57), Expect = 0.51 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = +1 Query: 412 PYSQHASHPSDHSLIYHDA 468 PY QH HP+ H + H A Sbjct: 173 PYPQHVLHPAHHPALLHPA 191 >AY330179-1|AAQ16285.1| 171|Anopheles gambiae odorant-binding protein AgamOBP53 protein. Length = 171 Score = 26.6 bits (56), Expect = 0.68 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +2 Query: 347 AMWGALEMYCPHHCQMWKLVP 409 A+W L+ PH CQM +L+P Sbjct: 20 ALWLFLKFEVPHCCQMEELIP 40 >AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl symporter protein. Length = 1127 Score = 26.6 bits (56), Expect = 0.68 Identities = 16/51 (31%), Positives = 23/51 (45%) Frame = +1 Query: 307 DELDRESSPVSSWSNVGRTGDVLPTPLSNVETRPSPYSQHASHPSDHSLIY 459 D L R S SS S++ +T V P P+ + Q + D SL+Y Sbjct: 866 DSLSRNVSQASSTSDLSKTISVAPDPIDINAKLITETGQRSLKRGDPSLLY 916 >AY334007-1|AAR01132.1| 202|Anopheles gambiae odorant receptor 1 protein. Length = 202 Score = 24.6 bits (51), Expect = 2.7 Identities = 17/43 (39%), Positives = 19/43 (44%) Frame = +2 Query: 104 LELTLEHFTTKAMLRFHPKLGSERGSEWLCCFCLHVRTGTIIL 232 L TL H K F P L S G WL F + V TII+ Sbjct: 77 LNCTLYH--PKQREEFSPVLRSMSGVFWLMIFLMFVAIFTIIM 117 >AY334006-1|AAR01131.1| 202|Anopheles gambiae odorant receptor 1 protein. Length = 202 Score = 24.6 bits (51), Expect = 2.7 Identities = 17/43 (39%), Positives = 19/43 (44%) Frame = +2 Query: 104 LELTLEHFTTKAMLRFHPKLGSERGSEWLCCFCLHVRTGTIIL 232 L TL H K F P L S G WL F + V TII+ Sbjct: 77 LNCTLYH--PKQREEFSPVLRSMSGVFWLMIFLMFVAIFTIIM 117 >AY334005-1|AAR01130.1| 202|Anopheles gambiae odorant receptor 1 protein. Length = 202 Score = 24.6 bits (51), Expect = 2.7 Identities = 17/43 (39%), Positives = 19/43 (44%) Frame = +2 Query: 104 LELTLEHFTTKAMLRFHPKLGSERGSEWLCCFCLHVRTGTIIL 232 L TL H K F P L S G WL F + V TII+ Sbjct: 77 LNCTLYH--PKQREEFSPVLRSMSGVFWLMIFLMFVAIFTIIM 117 >AF364130-1|AAL35506.1| 417|Anopheles gambiae putative odorant receptor Or1 protein. Length = 417 Score = 24.6 bits (51), Expect = 2.7 Identities = 17/43 (39%), Positives = 19/43 (44%) Frame = +2 Query: 104 LELTLEHFTTKAMLRFHPKLGSERGSEWLCCFCLHVRTGTIIL 232 L TL H K F P L S G WL F + V TII+ Sbjct: 111 LNCTLYH--PKQREEFSPVLQSMSGVFWLMIFLMFVAIFTIIM 151 >AJ515150-1|CAD56157.2| 737|Anopheles gambiae acetylcholinesterase protein. Length = 737 Score = 24.2 bits (50), Expect = 3.6 Identities = 12/43 (27%), Positives = 18/43 (41%) Frame = +1 Query: 307 DELDRESSPVSSWSNVGRTGDVLPTPLSNVETRPSPYSQHASH 435 DE D + WSN +TG+ P S+ ++ H H Sbjct: 621 DEKDFSRKIMRYWSNFAKTGNPNPNTASSEFPEWPKHTAHGRH 663 >AJ515149-1|CAD56156.1| 737|Anopheles gambiae acetylcholinesterase protein. Length = 737 Score = 24.2 bits (50), Expect = 3.6 Identities = 12/43 (27%), Positives = 18/43 (41%) Frame = +1 Query: 307 DELDRESSPVSSWSNVGRTGDVLPTPLSNVETRPSPYSQHASH 435 DE D + WSN +TG+ P S+ ++ H H Sbjct: 621 DEKDFSRKIMRYWSNFAKTGNPNPNTASSEFPEWPKHTAHGRH 663 >AJ488492-1|CAD32684.2| 623|Anopheles gambiae acetylcholinesterase protein. Length = 623 Score = 24.2 bits (50), Expect = 3.6 Identities = 12/43 (27%), Positives = 18/43 (41%) Frame = +1 Query: 307 DELDRESSPVSSWSNVGRTGDVLPTPLSNVETRPSPYSQHASH 435 DE D + WSN +TG+ P S+ ++ H H Sbjct: 507 DEKDFSRKIMRYWSNFAKTGNPNPNTASSEFPEWPKHTAHGRH 549 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 23.0 bits (47), Expect = 8.3 Identities = 10/29 (34%), Positives = 18/29 (62%) Frame = +1 Query: 298 RLLDELDRESSPVSSWSNVGRTGDVLPTP 384 R ++E R+S+P +S + + R+ PTP Sbjct: 1440 RDMEEGGRQSTPPASPARLARSSPASPTP 1468 >AY705401-1|AAU12510.1| 490|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 6 protein. Length = 490 Score = 23.0 bits (47), Expect = 8.3 Identities = 11/32 (34%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = +2 Query: 416 TLNMLHILVTTA*YTMMRMWVR--WLQWVPWL 505 T+ +L+ TA M W++ +LQW+PW+ Sbjct: 312 TVVVLNYHHRTADIHEMPPWIKSVFLQWLPWI 343 >AY705400-1|AAU12509.1| 490|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 6 protein. Length = 490 Score = 23.0 bits (47), Expect = 8.3 Identities = 11/32 (34%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = +2 Query: 416 TLNMLHILVTTA*YTMMRMWVR--WLQWVPWL 505 T+ +L+ TA M W++ +LQW+PW+ Sbjct: 312 TVVVLNYHHRTADIHEMPPWIKSVFLQWLPWI 343 >AJ276487-1|CAB90819.1| 375|Anopheles gambiae serine protease protein. Length = 375 Score = 23.0 bits (47), Expect = 8.3 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +1 Query: 538 GNRLICCPSSVFRSSTLPSPF 600 G L+CCP+ V + PS F Sbjct: 77 GGALVCCPAFVNEPNCGPSVF 97 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 726,129 Number of Sequences: 2352 Number of extensions: 15548 Number of successful extensions: 47 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 44 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 47 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 63977715 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -