BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0020 (389 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_1177 + 35147036-35147038,35147128-35147220,35147322-351474... 130 4e-31 01_06_1293 - 36050847-36051304,36052343-36052826 28 2.3 07_03_0011 + 12370624-12370684,12372573-12372718,12372793-123731... 27 4.0 02_05_1197 - 34908382-34908582,34908664-34908837,34909239-349093... 27 4.0 11_01_0658 + 5342508-5343602,5343697-5343764,5343994-5344042,534... 27 7.0 09_04_0040 - 14029565-14029810,14030904-14031182,14032056-14032832 27 7.0 09_02_0194 - 5641920-5642867,5642895-5642983,5643049-5643280 27 7.0 08_02_1601 - 28138206-28138597,28138928-28139054,28139150-281399... 27 7.0 05_01_0554 + 4856131-4856605,4858051-4858098,4860611-4860792,486... 27 7.0 >01_06_1177 + 35147036-35147038,35147128-35147220,35147322-35147406, 35147588-35147760 Length = 117 Score = 130 bits (314), Expect = 4e-31 Identities = 56/83 (67%), Positives = 69/83 (83%) Frame = +3 Query: 21 MTRKRRNGGRAKHGRGHVKAVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDINDASVYP 200 MT KRRNGGR KHGRGHVK +RC+NCA+C PKDKAIK+F +RNIVE AA+RD+ +A V+ Sbjct: 1 MTFKRRNGGRNKHGRGHVKYIRCSNCAKCCPKDKAIKRFQVRNIVEQAAIRDVQEACVHD 60 Query: 201 MFQLPKLYAKLHYCVSCASTAKL 269 + LPKLYAK+H+CVSCA A + Sbjct: 61 GYVLPKLYAKVHHCVSCAIHAHI 83 Score = 28.3 bits (60), Expect = 2.3 Identities = 13/32 (40%), Positives = 22/32 (68%) Frame = +2 Query: 254 LHSKVVRNRSKKDRRIRTPPKSNFPRDMSRPQ 349 +H+ +VR RS+++RR R PP+ F R + P+ Sbjct: 79 IHAHIVRVRSRENRRDRRPPE-RFRRRVPDPR 109 >01_06_1293 - 36050847-36051304,36052343-36052826 Length = 313 Score = 28.3 bits (60), Expect = 2.3 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = +3 Query: 180 NDASVYPMFQLPKLYAKLHYCVSCASTAKLSGT 278 N+AS YP Q P LY + C STA+ T Sbjct: 175 NNASYYPQQQTPLLYPGMEVCPHDKSTAQPPAT 207 >07_03_0011 + 12370624-12370684,12372573-12372718,12372793-12373129, 12374323-12374452,12375346-12375406,12375572-12375618, 12376873-12376950,12377195-12377345,12377495-12377558, 12377735-12377893,12378007-12378128,12378952-12378981, 12379050-12379124,12379563-12379644,12379809-12379938, 12381417-12382164,12382833-12383054,12383127-12383276, 12384851-12384904,12384985-12385058,12386130-12386204, 12386365-12386584 Length = 1071 Score = 27.5 bits (58), Expect = 4.0 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +2 Query: 80 REMHKLRAVRAKGQGHQKVRD*EHRRSGGGQR 175 R+ K ++ R K +G +K R EH R GG+R Sbjct: 101 RKREKTQSDRDKDKGKEKERMEEHERRPGGER 132 >02_05_1197 - 34908382-34908582,34908664-34908837,34909239-34909337, 34909444-34909644,34910229-34910336,34910498-34910882, 34911132-34911584,34911868-34912094,34912211-34912270 Length = 635 Score = 27.5 bits (58), Expect = 4.0 Identities = 15/36 (41%), Positives = 21/36 (58%) Frame = +3 Query: 159 AAAVRDINDASVYPMFQLPKLYAKLHYCVSCASTAK 266 +AA RD+ + V+PM L LY +L VS TA+ Sbjct: 40 SAAERDLLNFMVFPMLLLRLLYGQLWITVSRHQTAR 75 >11_01_0658 + 5342508-5343602,5343697-5343764,5343994-5344042, 5344217-5344333,5344438-5344506,5344631-5344725, 5345580-5345658,5346499-5346563,5347368-5347461, 5347675-5347744,5348363-5349357 Length = 931 Score = 26.6 bits (56), Expect = 7.0 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +1 Query: 256 PQQSCQEQIEERQKNPYSSQE 318 PQQS Q+Q EE+Q P SS + Sbjct: 617 PQQSQQQQPEEQQSIPQSSNQ 637 >09_04_0040 - 14029565-14029810,14030904-14031182,14032056-14032832 Length = 433 Score = 26.6 bits (56), Expect = 7.0 Identities = 15/50 (30%), Positives = 20/50 (40%) Frame = +3 Query: 24 TRKRRNGGRAKHGRGHVKAVRCTNCARCVPKDKAIKKFVIRNIVEAAAVR 173 T RR A G G AV C +CA P + A+ + + A R Sbjct: 78 TSSRRTDPPAGAGAGEDDAVACPSCAEPFPSELAVSDHLDGCLAAAGGAR 127 >09_02_0194 - 5641920-5642867,5642895-5642983,5643049-5643280 Length = 422 Score = 26.6 bits (56), Expect = 7.0 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +2 Query: 230 APLLRVMRLHSKVVRNRSKKDRRIRTPPK 316 +PL R++R + +KK+RR+R P K Sbjct: 317 SPLFRILRTLFGLCSAEAKKNRRLRNPAK 345 >08_02_1601 - 28138206-28138597,28138928-28139054,28139150-28139914, 28140714-28140929,28141433-28141903 Length = 656 Score = 26.6 bits (56), Expect = 7.0 Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 2/53 (3%) Frame = -1 Query: 188 GIVNISDRRRFYDVPNHELFDGLVLWHAPRAVCASHGFN--VTTSMLGASSIT 36 GI + D +YD + LF+ L+ P A +SH F+ V T + S+ T Sbjct: 439 GIDMVDDGMPYYDAMDDNLFNDLLSSVQPSAGSSSHAFSGPVLTQEVNNSTYT 491 >05_01_0554 + 4856131-4856605,4858051-4858098,4860611-4860792, 4861409-4863136 Length = 810 Score = 26.6 bits (56), Expect = 7.0 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = -1 Query: 170 DRRRFYDVPNHELFD 126 DR FYD PN+E FD Sbjct: 354 DRTLFYDEPNYEAFD 368 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,323,103 Number of Sequences: 37544 Number of extensions: 196830 Number of successful extensions: 594 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 584 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 594 length of database: 14,793,348 effective HSP length: 74 effective length of database: 12,015,092 effective search space used: 660830060 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -